(data stored in ACNUC1104 zone)

EMBL: CP002026.PE343

CP002026.PE343       Location/Qualifiers
FT   CDS             344630..345580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0347"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="KEGG: nha:Nham_3184 4-hydroxybenzoate
FT                   polyprenyltransferase; TIGRFAM: 4-hydroxybenzoate
FT                   polyprenyl transferase; PFAM: UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87680"
FT                   /db_xref="GOA:D7A264"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D7A264"
FT                   /inference="protein motif:TFAM:TIGR01474"
FT                   /protein_id="ADH87680.1"
FT                   /translation="MTAPSTPAGPAPADSAVSWVDRAPAALRPFLRLARIDRPIGSWLL
FT                   LIPCWWSVALALGMQARAGEADYSRALILGVLFAVGAVAMRGAGCTWNDILDRDIDVRV
FT                   ERTRARPLPAGQVTLLGAFAFLALQALVGLVVLICLPPFAIVTALASLGLVAIYPLMKR
FT                   VIWVPQAVLGLTFSWGALMGFAALLEELPAAAFLLYAGSVLWVIGYDTIYAHQDREDDA
FT                   LVGVKSSARLFGRATKPWLVGFYAAAAALIGVALVTAGAGPYAWGGLGIFVVQLGTQVR
FT                   RLDIDDRALCLKLFKSNRDAGLILLAGFLLDALVG"
     MTAPSTPAGP APADSAVSWV DRAPAALRPF LRLARIDRPI GSWLLLIPCW WSVALALGMQ        60
     ARAGEADYSR ALILGVLFAV GAVAMRGAGC TWNDILDRDI DVRVERTRAR PLPAGQVTLL       120
     GAFAFLALQA LVGLVVLICL PPFAIVTALA SLGLVAIYPL MKRVIWVPQA VLGLTFSWGA       180
     LMGFAALLEE LPAAAFLLYA GSVLWVIGYD TIYAHQDRED DALVGVKSSA RLFGRATKPW       240
     LVGFYAAAAA LIGVALVTAG AGPYAWGGLG IFVVQLGTQV RRLDIDDRAL CLKLFKSNRD       300
     AGLILLAGFL LDALVG                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page