(data stored in ACNUC1104 zone)

EMBL: CP002026.PE346

CP002026.PE346       Location/Qualifiers
FT   CDS             347437..348123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0350"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG: xau:Xaut_0066 OstA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87683"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2W5"
FT                   /inference="protein motif:PFAM:PF03968"
FT                   /protein_id="ADH87683.1"
FT                   /translation="MITLLRFAGAAGLALLVTGAACLGPLARPALAQARNVPNALQGFA
FT                   ANRDEPIRINANSLEVRDQQKQAVFTGNVVVIQGDTTLRCKELVVYYDGKESGGKAGAP
FT                   ASSEALASGSPINSSAIRRLEINGSVVVTTKEQTATGDYGTFETASNTITLNGSPVVLT
FT                   SGPNVIRGKKLTVDLASGMSRFDGGRIESLIVPNSMKDGALPGGPGAKPGAGAKPAAKP
FT                   GAKPTQ"
     MITLLRFAGA AGLALLVTGA ACLGPLARPA LAQARNVPNA LQGFAANRDE PIRINANSLE        60
     VRDQQKQAVF TGNVVVIQGD TTLRCKELVV YYDGKESGGK AGAPASSEAL ASGSPINSSA       120
     IRRLEINGSV VVTTKEQTAT GDYGTFETAS NTITLNGSPV VLTSGPNVIR GKKLTVDLAS       180
     GMSRFDGGRI ESLIVPNSMK DGALPGGPGA KPGAGAKPAA KPGAKPTQ                    228
//

If you have problems or comments...

PBIL Back to PBIL home page