(data stored in ACNUC1104 zone)

EMBL: CP002026.PE349

CP002026.PE349       Location/Qualifiers
FT   CDS             351116..351709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0353"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="KEGG: xau:Xaut_2035 sigma 54 modulation
FT                   protein/ribosomal protein S30EA; TIGRFAM: ribosomal subunit
FT                   interface protein; PFAM: sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87686"
FT                   /db_xref="GOA:D7A2W8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2W8"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADH87686.1"
FT                   /translation="MPLRVSGKNIDVGEALRQRVADRVAGAMGKYFDGGWSGHVTVARE
FT                   GSGYRSDCALHLDSGTILQAHADAQDPYSSADAAVERIETRLRRYKSRIKRRAANGEGE
FT                   GLAETVPLTVFSTPDHEDAELLEGWNPTVVCEATANLPRLSVSDAVLELDFTGAAVLVF
FT                   RHAGHGRINVVYRRGDGHVGWVDPPVSAVTEEVH"
     MPLRVSGKNI DVGEALRQRV ADRVAGAMGK YFDGGWSGHV TVAREGSGYR SDCALHLDSG        60
     TILQAHADAQ DPYSSADAAV ERIETRLRRY KSRIKRRAAN GEGEGLAETV PLTVFSTPDH       120
     EDAELLEGWN PTVVCEATAN LPRLSVSDAV LELDFTGAAV LVFRHAGHGR INVVYRRGDG       180
     HVGWVDPPVS AVTEEVH                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page