(data stored in ACNUC1104 zone)

EMBL: CP002026.PE35

CP002026.PE35        Location/Qualifiers
FT   CDS             27813..28172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_0752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87372"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV8"
FT                   /inference="similar to AA sequence:KEGG:Rleg2_0752"
FT                   /protein_id="ADH87372.1"
FT                   /translation="MLGLLDTIKIGAGLIAGVSLTWAAQTAYDRLVDDPAVAAAAREGY
FT                   VQIAEKTALQAQLAELSRQRAASDEALRAALARAENAKQEAARAQAQYDDLVVQDSGAD
FT                   GARVDGSDVQWLRDY"
     MLGLLDTIKI GAGLIAGVSL TWAAQTAYDR LVDDPAVAAA AREGYVQIAE KTALQAQLAE        60
     LSRQRAASDE ALRAALARAE NAKQEAARAQ AQYDDLVVQD SGADGARVDG SDVQWLRDY        119
//

If you have problems or comments...

PBIL Back to PBIL home page