(data stored in ACNUC1104 zone)

EMBL: CP002026.PE351

CP002026.PE351       Location/Qualifiers
FT   CDS             352397..352720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mno:Mnod_7736 transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87688"
FT                   /db_xref="GOA:D7A2X0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87688.1"
FT                   /translation="MPATPVPANLALAPEQCRAARAMLDWSVEELAARAHVTVDWLAAF
FT                   EQGREPGDGFDHEAERLRRVLEEAGIELLDAGEASSGGGPGLRIKQKAGYIPAERLSSA
FT                   NDV"
     MPATPVPANL ALAPEQCRAA RAMLDWSVEE LAARAHVTVD WLAAFEQGRE PGDGFDHEAE        60
     RLRRVLEEAG IELLDAGEAS SGGGPGLRIK QKAGYIPAER LSSANDV                     107
//

If you have problems or comments...

PBIL Back to PBIL home page