(data stored in ACNUC1104 zone)

EMBL: CP002026.PE357

CP002026.PE357       Location/Qualifiers
FT   CDS             357701..359269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0361"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: azc:AZC_4070 periplasmic sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87694"
FT                   /db_xref="GOA:D7A2X6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH87694.1"
FT                   /translation="MKKRSGAGSQAIALPAAAAGFGELRLHAGTPQVTAETAAATSPKP
FT                   PRHLGLSGKLLAFTLAFVLLAEVLILVPAVAAFRLNWLSDRLAGARTAALVLDAAPDGM
FT                   ISPQLTQELLRSVGAITVALKRDDTRRLLASTDMPPEVDHHADVRDVGPWQAVSEAFDT
FT                   LLARDGRVIRAVGTPPRGDGFVEIVIDETPLRKAMLRFTGNLLLVSLVIAALTGALVYL
FT                   GLAWMFVRPMRRLTQRMVAFRADPSHPVPEVETDGRMDEIGQAERELTAMQQQIAETLQ
FT                   QKSHLAALGLAVSKINHDLRNLLASVQLISDRLADIRDPAVQRFAPKLEVALDRAIAYC
FT                   EHTLAYGKAQEPAPERRMVPLAPLVAEVRDTLGLGPDEAQGIGFVESVDRELEVDADPD
FT                   QLFRVLLNLCRNAVEALSARSPNEPSRDQIRITGRREGAIVIIEVADTGPGVPERARAH
FT                   LFEAFQGSARRGGTGLGLAIAAELMHAHGGDIQLVPGTIGATFQLRVPDRPVDLEAHRA
FT                   LRQHG"
     MKKRSGAGSQ AIALPAAAAG FGELRLHAGT PQVTAETAAA TSPKPPRHLG LSGKLLAFTL        60
     AFVLLAEVLI LVPAVAAFRL NWLSDRLAGA RTAALVLDAA PDGMISPQLT QELLRSVGAI       120
     TVALKRDDTR RLLASTDMPP EVDHHADVRD VGPWQAVSEA FDTLLARDGR VIRAVGTPPR       180
     GDGFVEIVID ETPLRKAMLR FTGNLLLVSL VIAALTGALV YLGLAWMFVR PMRRLTQRMV       240
     AFRADPSHPV PEVETDGRMD EIGQAERELT AMQQQIAETL QQKSHLAALG LAVSKINHDL       300
     RNLLASVQLI SDRLADIRDP AVQRFAPKLE VALDRAIAYC EHTLAYGKAQ EPAPERRMVP       360
     LAPLVAEVRD TLGLGPDEAQ GIGFVESVDR ELEVDADPDQ LFRVLLNLCR NAVEALSARS       420
     PNEPSRDQIR ITGRREGAIV IIEVADTGPG VPERARAHLF EAFQGSARRG GTGLGLAIAA       480
     ELMHAHGGDI QLVPGTIGAT FQLRVPDRPV DLEAHRALRQ HG                          522
//

If you have problems or comments...

PBIL Back to PBIL home page