(data stored in ACNUC1104 zone)

EMBL: CP002026.PE359

CP002026.PE359       Location/Qualifiers
FT   CDS             complement(361273..362031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0363"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bpy:Bphyt_6213 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87696"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2X8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87696.1"
FT                   /translation="MTENRELAGHTALVTGAARNVGRAIAVALARAGARVVVHARSSVD
FT                   AANETVAQCQQAFGGADGAFAHFADLTDPEAVRIMFAEVEARFGGLDLLVHNAAERADG
FT                   PFDEISFAEWRRIVGSILDSAFLCDQAALPLLRRSAAASIIHIGGVAAHVGVRHRAHVS
FT                   AAKAGIVGLTRALAAEFASEQITVNCISPAQMETERKGHMPEHFRQRPVPLGRPGQPAE
FT                   LASLVCFLAGPSGRFITGQTIHLNGGWYMG"
     MTENRELAGH TALVTGAARN VGRAIAVALA RAGARVVVHA RSSVDAANET VAQCQQAFGG        60
     ADGAFAHFAD LTDPEAVRIM FAEVEARFGG LDLLVHNAAE RADGPFDEIS FAEWRRIVGS       120
     ILDSAFLCDQ AALPLLRRSA AASIIHIGGV AAHVGVRHRA HVSAAKAGIV GLTRALAAEF       180
     ASEQITVNCI SPAQMETERK GHMPEHFRQR PVPLGRPGQP AELASLVCFL AGPSGRFITG       240
     QTIHLNGGWY MG                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page