(data stored in ACNUC1104 zone)

EMBL: CP002026.PE36

CP002026.PE36        Location/Qualifiers
FT   CDS             28147..28425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_0753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87373"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87373.1"
FT                   /translation="MCSGCATTERRLTVAAGTTGRIAASVDLPDLPAECRAHMARVVPK
FT                   EGEKWRWVQKRWEIVADTEDKRTARCAAFYDDVAEGFEVTGVAGDAE"
     MCSGCATTER RLTVAAGTTG RIAASVDLPD LPAECRAHMA RVVPKEGEKW RWVQKRWEIV        60
     ADTEDKRTAR CAAFYDDVAE GFEVTGVAGD AE                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page