(data stored in ACNUC1104 zone)

EMBL: CP002026.PE364

CP002026.PE364       Location/Qualifiers
FT   CDS             complement(365558..367753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0368"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG: bbr:BB1576
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87701"
FT                   /db_xref="GOA:D7A2Y3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y3"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ADH87701.1"
FT                   /translation="MTVQDTHTLRAARGEALIAEARANGRGSLDEAAGKALLADFGVRV
FT                   PRSRFAADVVQAAEIAGELDGPFVVKVVSPDILHKSDAGGVALRLADADAVRAAVEAMA
FT                   AKPLIAAAKVDGWLVEEMMPSGREIVIGGYRDPQFGPMIMVGLGGIFVEVLRDISFRIC
FT                   PIEAKDAEEMLAELKGHALLDGARGEAGIDKAALIDIMLRIGGAGGLLMRHQADIAELD
FT                   LNPVIASQNGAVAVDARVILTPQAEADIAFEAPDASPLDAFRPLFEPRTVAVLGASTKD
FT                   VAIANTFIRRMKAFGYEGSIYPIHPAAEEIEGLKAYPSLADTPEPVDYAYIAVGAERIP
FT                   GILAAAGGRCRIAQVISSGFGELEDGKALQDALVEGGRTGGARILGPNCLGTYSPRGGL
FT                   TFPAEAPKEVGTIGVISQSGGLTTDIIKRGEWRGLRFSGAVTIGNSADVEPHELLAYYL
FT                   ADPQTRAIGIYMEDVKHGRAFYEQLKKASKPVVILKGGRSALGRLAAASHTGALAGDEK
FT                   AWEALQKQTPAVLVATVDEFIDLLLALQHFDLHPDHPTRTVTLFGNGGGSSVLGTDAFA
FT                   GAGLEVAPYGEEARRLLEAMKLPPGTSVANPIDTPVRTLQEKDGFVAGEILDIVYGHAH
FT                   PDAVLMHLNLSAFVGRGSVDPIDNLFTVVGQTKEKWPGGPHFALALRTDGSAALDDRRR
FT                   HYREKARAIGVPVFDEIAPAAKALAGIGHLERRLNGR"
     MTVQDTHTLR AARGEALIAE ARANGRGSLD EAAGKALLAD FGVRVPRSRF AADVVQAAEI        60
     AGELDGPFVV KVVSPDILHK SDAGGVALRL ADADAVRAAV EAMAAKPLIA AAKVDGWLVE       120
     EMMPSGREIV IGGYRDPQFG PMIMVGLGGI FVEVLRDISF RICPIEAKDA EEMLAELKGH       180
     ALLDGARGEA GIDKAALIDI MLRIGGAGGL LMRHQADIAE LDLNPVIASQ NGAVAVDARV       240
     ILTPQAEADI AFEAPDASPL DAFRPLFEPR TVAVLGASTK DVAIANTFIR RMKAFGYEGS       300
     IYPIHPAAEE IEGLKAYPSL ADTPEPVDYA YIAVGAERIP GILAAAGGRC RIAQVISSGF       360
     GELEDGKALQ DALVEGGRTG GARILGPNCL GTYSPRGGLT FPAEAPKEVG TIGVISQSGG       420
     LTTDIIKRGE WRGLRFSGAV TIGNSADVEP HELLAYYLAD PQTRAIGIYM EDVKHGRAFY       480
     EQLKKASKPV VILKGGRSAL GRLAAASHTG ALAGDEKAWE ALQKQTPAVL VATVDEFIDL       540
     LLALQHFDLH PDHPTRTVTL FGNGGGSSVL GTDAFAGAGL EVAPYGEEAR RLLEAMKLPP       600
     GTSVANPIDT PVRTLQEKDG FVAGEILDIV YGHAHPDAVL MHLNLSAFVG RGSVDPIDNL       660
     FTVVGQTKEK WPGGPHFALA LRTDGSAALD DRRRHYREKA RAIGVPVFDE IAPAAKALAG       720
     IGHLERRLNG R                                                            731
//

If you have problems or comments...

PBIL Back to PBIL home page