(data stored in ACNUC1104 zone)

EMBL: CP002026.PE367

CP002026.PE367       Location/Qualifiers
FT   CDS             370858..371829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   reh:H16_B2308 extra-cytoplasmic solute receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87704"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y6"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ADH87704.1"
FT                   /translation="MLKFLLRTAALAAAIAMMPAGARADFPDKPIRYLLHVSPGGATDV
FT                   MARKLAIAMEKILGVPLVVENKPGGRGATQLAELAAAKPDGYTIGAVTSTHIGAFNQTL
FT                   KQYKVDSFDWIARLVNEPYLIVVNKDSKITSMKDLVEAANAKPGSVVMAGFVRGSGGHF
FT                   AWEIMAKSADLDSKKVRWVPFDSVGDAVTAALGNHAEVAIAYVDLVKTHVQAGNLRVVA
FT                   VMSDKRVPQFPDVPTLKEQGYAADTSWQQMRGIIGPKGIPEPIKAKLADAVKQALETPE
FT                   LKAYMEESALVPAFQGPADFTATAQRENAATKEWMATLGLTR"
     MLKFLLRTAA LAAAIAMMPA GARADFPDKP IRYLLHVSPG GATDVMARKL AIAMEKILGV        60
     PLVVENKPGG RGATQLAELA AAKPDGYTIG AVTSTHIGAF NQTLKQYKVD SFDWIARLVN       120
     EPYLIVVNKD SKITSMKDLV EAANAKPGSV VMAGFVRGSG GHFAWEIMAK SADLDSKKVR       180
     WVPFDSVGDA VTAALGNHAE VAIAYVDLVK THVQAGNLRV VAVMSDKRVP QFPDVPTLKE       240
     QGYAADTSWQ QMRGIIGPKG IPEPIKAKLA DAVKQALETP ELKAYMEESA LVPAFQGPAD       300
     FTATAQRENA ATKEWMATLG LTR                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page