(data stored in ACNUC1104 zone)

EMBL: CP002026.PE368

CP002026.PE368       Location/Qualifiers
FT   CDS             371906..372409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_1331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87705"
FT                   /db_xref="GOA:D7A2Y7"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y7"
FT                   /inference="similar to AA sequence:KEGG:Xaut_1331"
FT                   /protein_id="ADH87705.1"
FT                   /translation="MATQHDEPTVDVSAEPKDLSFRLELGDALAGAALLAFAVTFWVLG
FT                   ADIDDGGGYGVGAATFPRGIALLLGIGALVLLANGLVHLFGPPSGHLVTIGRPLHVIAG
FT                   MGLMLAFAPAMRHLGYYPTMGVFLAALLWVADCRRPLHILAYVAGFLLFSKVVFEMVLS
FT                   IPLP"
     MATQHDEPTV DVSAEPKDLS FRLELGDALA GAALLAFAVT FWVLGADIDD GGGYGVGAAT        60
     FPRGIALLLG IGALVLLANG LVHLFGPPSG HLVTIGRPLH VIAGMGLMLA FAPAMRHLGY       120
     YPTMGVFLAA LLWVADCRRP LHILAYVAGF LLFSKVVFEM VLSIPLP                     167
//

If you have problems or comments...

PBIL Back to PBIL home page