(data stored in ACNUC1104 zone)

EMBL: CP002026.PE37

CP002026.PE37        Location/Qualifiers
FT   CDS             28415..28699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_5763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87374"
FT                   /db_xref="GOA:D6ZZW0"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZW0"
FT                   /inference="similar to AA sequence:KEGG:BBta_5763"
FT                   /protein_id="ADH87374.1"
FT                   /translation="MRNEPNKSVVLSISRDELREEMEKAVRRGLEDVGLYTEDAEDRRE
FT                   TREDMRFVRRLRRATDGIAAKVGYTVLAIVTGGFLVVIWAGIKVHVLKQ"
     MRNEPNKSVV LSISRDELRE EMEKAVRRGL EDVGLYTEDA EDRRETREDM RFVRRLRRAT        60
     DGIAAKVGYT VLAIVTGGFL VVIWAGIKVH VLKQ                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page