(data stored in ACNUC1104 zone)

EMBL: CP002026.PE370

CP002026.PE370       Location/Qualifiers
FT   CDS             373941..374834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0374"
FT                   /product="Citrate (pro-3S)-lyase"
FT                   /EC_number="4.1.3.6"
FT                   /note="KEGG: bja:bll0499 citrate lyase beta subunit; PFAM:
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87707"
FT                   /db_xref="GOA:D7A2Y9"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Y9"
FT                   /inference="protein motif:PRIAM:4.1.3.6"
FT                   /protein_id="ADH87707.1"
FT                   /translation="MNGERPLRSVLYVPGIRERALEKIRELDVDALIIDLEDSIAPEMK
FT                   PQARENACRAVSAGGYGFRQVAIRVNSRGTRWFEDDLAAVAAAGPDIVVLSKVEAPDDI
FT                   GEAHRLLRSAGAAPGLQLWAMIETPLGLLDLSEIVREGRKQPDNRLAGLVLGTNDIAKD
FT                   TGVLAGDDRAAMVPWLLNAVLVARAHGLSVFDGVYNAFTDMDGFVRECAQGRQLGFDGK
FT                   TLIHPSQIALANRLFAPADEDVAEALTIVEAFALPENADKGVITLGGKMVERLHAMSAK
FT                   RLIAIDAAIKARGSFA"
     MNGERPLRSV LYVPGIRERA LEKIRELDVD ALIIDLEDSI APEMKPQARE NACRAVSAGG        60
     YGFRQVAIRV NSRGTRWFED DLAAVAAAGP DIVVLSKVEA PDDIGEAHRL LRSAGAAPGL       120
     QLWAMIETPL GLLDLSEIVR EGRKQPDNRL AGLVLGTNDI AKDTGVLAGD DRAAMVPWLL       180
     NAVLVARAHG LSVFDGVYNA FTDMDGFVRE CAQGRQLGFD GKTLIHPSQI ALANRLFAPA       240
     DEDVAEALTI VEAFALPENA DKGVITLGGK MVERLHAMSA KRLIAIDAAI KARGSFA          297
//

If you have problems or comments...

PBIL Back to PBIL home page