(data stored in ACNUC1104 zone)

EMBL: CP002026.PE372

CP002026.PE372       Location/Qualifiers
FT   CDS             376040..377665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0376"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: ABC transporter related;
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; KEGG: bbt:BBta_6505 ABC transporter
FT                   permease/ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87709"
FT                   /db_xref="GOA:D7A2Z1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z1"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87709.1"
FT                   /translation="MDLFLHYLSMPYLIDGVGYTLLITVLGLLGGLLMGVVLAAMQLSR
FT                   FRALAIIARGYSIIFRGTPLILQMVFCYNALPLIGIKLTAISAAGLALALNEAPFIAEI
FT                   LRSNVIGVDRGQVSAGQALGMTPAAIMRRVIAPQAIRSMVPALGNEAVSALKNSSLASV
FT                   VAVQELTLRSTQLASATFDFFSIFFASGLMYLILTGAIAVIQIVVEMLLDLDRPPPKEQ
FT                   LRRFLRAMLPGRAEPVPADAAGAVPPDVAKEILEEIAVDPLPPASPKAALARPDREARA
FT                   RRLAGNNVAVEVKGLRKRYGDQTVLDGIDLTVRAGEVVALLGPSGSGKSTLLRCINRLE
FT                   GWEDGTIRVGGRFLGSDEAGRPLSPRTTAQMRASVGVGMVFQQFNLFGHLTAEENIAGP
FT                   LRWVQGLSRLDARRRAQELLERVGLAHRADALPRHLSGGQQQRVAIARAVAPGPSVLLL
FT                   DEPTSALDPELVGEVLEVIRRLAVEDGLAMIISTHQLHFAGDVADRIVFLAGGSIVEEG
FT                   PAQQVLREPRHPLTARFLSTMAAD"
     MDLFLHYLSM PYLIDGVGYT LLITVLGLLG GLLMGVVLAA MQLSRFRALA IIARGYSIIF        60
     RGTPLILQMV FCYNALPLIG IKLTAISAAG LALALNEAPF IAEILRSNVI GVDRGQVSAG       120
     QALGMTPAAI MRRVIAPQAI RSMVPALGNE AVSALKNSSL ASVVAVQELT LRSTQLASAT       180
     FDFFSIFFAS GLMYLILTGA IAVIQIVVEM LLDLDRPPPK EQLRRFLRAM LPGRAEPVPA       240
     DAAGAVPPDV AKEILEEIAV DPLPPASPKA ALARPDREAR ARRLAGNNVA VEVKGLRKRY       300
     GDQTVLDGID LTVRAGEVVA LLGPSGSGKS TLLRCINRLE GWEDGTIRVG GRFLGSDEAG       360
     RPLSPRTTAQ MRASVGVGMV FQQFNLFGHL TAEENIAGPL RWVQGLSRLD ARRRAQELLE       420
     RVGLAHRADA LPRHLSGGQQ QRVAIARAVA PGPSVLLLDE PTSALDPELV GEVLEVIRRL       480
     AVEDGLAMII STHQLHFAGD VADRIVFLAG GSIVEEGPAQ QVLREPRHPL TARFLSTMAA       540
     D                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page