(data stored in ACNUC1104 zone)

EMBL: CP002026.PE373

CP002026.PE373       Location/Qualifiers
FT   CDS             377733..378971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0377"
FT                   /product="Acetamidase/Formamidase"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG: bra:BRADO1537
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87710"
FT                   /db_xref="GOA:D7A2Z2"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z2"
FT                   /inference="protein motif:PFAM:PF03069"
FT                   /protein_id="ADH87710.1"
FT                   /translation="MTKHHLPATPDTVHWGYFSRTLDPVLTLKSGERAVIETITHHAND
FT                   DYERMIAGDRAAEEIFLWTKEAKTLRRRGAGATEGPFTYGSGEGLGVHLLTGPIAVEGA
FT                   EPGDVIEVRIIDAWPRPSANPAYQGRFFGSNPSANWGFQYKDLIEEPKPREVVTIYELD
FT                   MGEAAVKALYSYRWTPQTDPDGIVHPTIDYPGVRVDHGTIVKKEGILPGIKVPARLHFG
FT                   TMGLAPAEADFVSTIPPNYTGGNMDDWRIAKGARMYYPVAVPGGLFSCGDAHASQGDSE
FT                   LSGTAIEISLTGEFEFILHKKEQLDGTLLEGLNHPLLENDELWSVYGFSVANYLTELGP
FT                   DHQTEILKRGSLDNAMRDAFRKLRRFLMTTQKLSEDEAISLMSVAADFAVTQVVDANWG
FT                   LTGSIRKSIFAGR"
     MTKHHLPATP DTVHWGYFSR TLDPVLTLKS GERAVIETIT HHANDDYERM IAGDRAAEEI        60
     FLWTKEAKTL RRRGAGATEG PFTYGSGEGL GVHLLTGPIA VEGAEPGDVI EVRIIDAWPR       120
     PSANPAYQGR FFGSNPSANW GFQYKDLIEE PKPREVVTIY ELDMGEAAVK ALYSYRWTPQ       180
     TDPDGIVHPT IDYPGVRVDH GTIVKKEGIL PGIKVPARLH FGTMGLAPAE ADFVSTIPPN       240
     YTGGNMDDWR IAKGARMYYP VAVPGGLFSC GDAHASQGDS ELSGTAIEIS LTGEFEFILH       300
     KKEQLDGTLL EGLNHPLLEN DELWSVYGFS VANYLTELGP DHQTEILKRG SLDNAMRDAF       360
     RKLRRFLMTT QKLSEDEAIS LMSVAADFAV TQVVDANWGL TGSIRKSIFA GR               412
//

If you have problems or comments...

PBIL Back to PBIL home page