(data stored in ACNUC1104 zone)

EMBL: CP002026.PE376

CP002026.PE376       Location/Qualifiers
FT   CDS             382337..383251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0380"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: bid:Bind_1549 AraC family transcriptional
FT                   regulator; PFAM: AraC-type transcriptional regulator domain
FT                   protein; helix-turn-helix- domain containing protein AraC
FT                   type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87713"
FT                   /db_xref="GOA:D7A2Z5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z5"
FT                   /inference="protein motif:PFAM:PF06719"
FT                   /protein_id="ADH87713.1"
FT                   /translation="MKAVEERSARRELVELAERLAPRHGYNPTGLDNVRLLRTEAVLHD
FT                   IPVLYRPGAVFVLQGRKQGLLEDEVYLYDEEHYLAVSVPVSFRMQSIASAERPLLAVYV
FT                   EFDMRLAAEIASEVGVRRAEPAAGKMRGLASSRMEPAIEDVVLRLLRALRDPVELAVLG
FT                   AAISRELHYRVLVGPQGGAMIAALQQRGTSGRIVQSLARLRETYDSALSVAALAGEAGM
FT                   SVPSYHVHFKALTGSTPMQYVKAMRLHEARLMIARQDRTIAEVAACVGYASPAQFSRDF
FT                   KRHFRRTASEEARWVRQHLGELA"
     MKAVEERSAR RELVELAERL APRHGYNPTG LDNVRLLRTE AVLHDIPVLY RPGAVFVLQG        60
     RKQGLLEDEV YLYDEEHYLA VSVPVSFRMQ SIASAERPLL AVYVEFDMRL AAEIASEVGV       120
     RRAEPAAGKM RGLASSRMEP AIEDVVLRLL RALRDPVELA VLGAAISREL HYRVLVGPQG       180
     GAMIAALQQR GTSGRIVQSL ARLRETYDSA LSVAALAGEA GMSVPSYHVH FKALTGSTPM       240
     QYVKAMRLHE ARLMIARQDR TIAEVAACVG YASPAQFSRD FKRHFRRTAS EEARWVRQHL       300
     GELA                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page