(data stored in ACNUC1104 zone)

EMBL: CP002026.PE377

CP002026.PE377       Location/Qualifiers
FT   CDS             complement(383279..384586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0381"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bpy:Bphyt_6342 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87714"
FT                   /db_xref="GOA:D7A2Z6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z6"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADH87714.1"
FT                   /translation="MSAADIFAEGFKAQPYWWDAAEPETDLDPLPARADAVVIGSGYAG
FT                   LNAATELARAGLDVVVIDGERIGEGGSTRSGGMVSSGQKLVVGGAIKGIDPELFNRMIG
FT                   DSISSFDYLQNLIQGEGLDADLKITGRFFGAHAPSLLQPTWHNGRILAEKTGVTVHLYD
FT                   RANQRHAIGSDYYHGGIVVDEYGGLHPGKYHQALRQRARASGAKLRSHAKAGPVQDADG
FT                   GLKRVPTTRGDILARHVVSATNGYTRKDGHPDLARRVVPVKSYQIATEPLPADLIETLI
FT                   PRARMISDTRRDVIYSRPSPDGTRILFGSRPGFFEREDRDAAPAIYERMTEIWPELKAY
FT                   RISHAWSGFVAMTVDKVAHMGRRDNSDFAVGCNGNGVALMSYLGYQTAQKILGRQNRTT
FT                   AFDREQFTAVPLYSGNPWFVPIVAAWYRLQDWYERR"
     MSAADIFAEG FKAQPYWWDA AEPETDLDPL PARADAVVIG SGYAGLNAAT ELARAGLDVV        60
     VIDGERIGEG GSTRSGGMVS SGQKLVVGGA IKGIDPELFN RMIGDSISSF DYLQNLIQGE       120
     GLDADLKITG RFFGAHAPSL LQPTWHNGRI LAEKTGVTVH LYDRANQRHA IGSDYYHGGI       180
     VVDEYGGLHP GKYHQALRQR ARASGAKLRS HAKAGPVQDA DGGLKRVPTT RGDILARHVV       240
     SATNGYTRKD GHPDLARRVV PVKSYQIATE PLPADLIETL IPRARMISDT RRDVIYSRPS       300
     PDGTRILFGS RPGFFEREDR DAAPAIYERM TEIWPELKAY RISHAWSGFV AMTVDKVAHM       360
     GRRDNSDFAV GCNGNGVALM SYLGYQTAQK ILGRQNRTTA FDREQFTAVP LYSGNPWFVP       420
     IVAAWYRLQD WYERR                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page