(data stored in ACNUC1104 zone)

EMBL: CP002026.PE378

CP002026.PE378       Location/Qualifiers
FT   CDS             complement(384673..385419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0382"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bxe:Bxe_A2431 polar amino acid ABC transporter
FT                   ATPase; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87715"
FT                   /db_xref="GOA:D7A2Z7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87715.1"
FT                   /translation="MNRADTLIELDGVTKSFGSFQVLKGISLSVKDGEAVCIIGPSGSG
FT                   KSTILRCINGLIPIDGGSIRVGQHEVHKLKTEKEMRPLRHQVSMVFQQYNLFPHRTVLQ
FT                   NIMMAPVQVLGHDAREVEARAHRLLAKVRLSNKADAYPGQLSGGQQQRVAIARALAMEP
FT                   QVILFDEVTAALDPETVKEVLTAIRELVDDRLTCILVTHEMKFAREVADRVCFTDHGRI
FT                   VESGPPAQIFDAPQDARTREFLGQVL"
     MNRADTLIEL DGVTKSFGSF QVLKGISLSV KDGEAVCIIG PSGSGKSTIL RCINGLIPID        60
     GGSIRVGQHE VHKLKTEKEM RPLRHQVSMV FQQYNLFPHR TVLQNIMMAP VQVLGHDARE       120
     VEARAHRLLA KVRLSNKADA YPGQLSGGQQ QRVAIARALA MEPQVILFDE VTAALDPETV       180
     KEVLTAIREL VDDRLTCILV THEMKFAREV ADRVCFTDHG RIVESGPPAQ IFDAPQDART       240
     REFLGQVL                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page