(data stored in ACNUC1104 zone)

EMBL: CP002026.PE379

CP002026.PE379       Location/Qualifiers
FT   CDS             complement(385416..386228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0383"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: bxe:Bxe_A2432 polar amino acid ABC transporter
FT                   inner membrane protein; TIGRFAM: polar amino acid ABC
FT                   transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87716"
FT                   /db_xref="GOA:D7A2Z8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A2Z8"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87716.1"
FT                   /translation="MQWPLTYHEKKRAVQLAIVLALVAWLAADALTGGAANWQRVWLRL
FT                   PLLLTGSGSGWPLTGGFVLNIFLGLCSMVLAAVMGTLLAFGMMARNRAIRLPCFFIMNF
FT                   LRNSPWLVLLFAMLYIIPFNVRLFGFSIAVPAFVKAVIGLALPTGANFAEIIRGAVQSI
FT                   HSGQWEAARAFGYMPMAIYWRIILPQALRRMIPGWMNLYALLMIATSLATVTGIQDVIT
FT                   TLNTLLSMENERVIVYFYIATLFLFFAYCYPIALLARRMEQSVKGDAL"
     MQWPLTYHEK KRAVQLAIVL ALVAWLAADA LTGGAANWQR VWLRLPLLLT GSGSGWPLTG        60
     GFVLNIFLGL CSMVLAAVMG TLLAFGMMAR NRAIRLPCFF IMNFLRNSPW LVLLFAMLYI       120
     IPFNVRLFGF SIAVPAFVKA VIGLALPTGA NFAEIIRGAV QSIHSGQWEA ARAFGYMPMA       180
     IYWRIILPQA LRRMIPGWMN LYALLMIATS LATVTGIQDV ITTLNTLLSM ENERVIVYFY       240
     IATLFLFFAY CYPIALLARR MEQSVKGDAL                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page