(data stored in ACNUC1104 zone)

EMBL: CP002026.PE382

CP002026.PE382       Location/Qualifiers
FT   CDS             387996..388760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0386"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: mlo:mll9009 transcription regulator; PFAM:
FT                   regulatory protein IclR; Transcriptional regulator IclR;
FT                   SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87719"
FT                   /db_xref="GOA:D7A301"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A301"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADH87719.1"
FT                   /translation="MAAPTASGSQLLDRAALLLDLIADGTSEGATLKELVERSGLNTAT
FT                   CHRILNTLVGHRLLARDDKRKRYRLGAKMFIYGARAARGPGLISRCEMSLSRLRKKTGE
FT                   TTHLMARHNHDSLCLDRRDGECVVQTLTGSIGGSVPLGAGPGSIAMLAFLDREEQEFIL
FT                   RANEPRFAAFRDLAADKVWRLIEETRARGHAVDIGELIPGIAGVAMPILDETGVPVASL
FT                   GFTFLCAKIVPGLVENYAALLRAEIDLIERRS"
     MAAPTASGSQ LLDRAALLLD LIADGTSEGA TLKELVERSG LNTATCHRIL NTLVGHRLLA        60
     RDDKRKRYRL GAKMFIYGAR AARGPGLISR CEMSLSRLRK KTGETTHLMA RHNHDSLCLD       120
     RRDGECVVQT LTGSIGGSVP LGAGPGSIAM LAFLDREEQE FILRANEPRF AAFRDLAADK       180
     VWRLIEETRA RGHAVDIGEL IPGIAGVAMP ILDETGVPVA SLGFTFLCAK IVPGLVENYA       240
     ALLRAEIDLI ERRS                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page