(data stored in ACNUC1104 zone)

EMBL: CP002026.PE383

CP002026.PE383       Location/Qualifiers
FT   CDS             complement(388768..389469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0387"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ara:Arad_9641 short-chain dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87720"
FT                   /db_xref="GOA:D7A302"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A302"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87720.1"
FT                   /translation="MTARTVLISGGGRGIGAATGRVMMQAGWNVSLGMRSPALPDWAEE
FT                   GPGQVQACAYEATDPAAAERWVAEARARFGGIDAVVANAGIMIRKDVIAAEDEELARLM
FT                   EVHVAAPRRLAKAAWNDLAASGRGRVIIVSSLSGKRVKSAISSLYSVSKFAATGLAHAL
FT                   RHTGFELGIRATAVCPGFVATDMGLPLTTRTAEELTDPADIGRAIRFLIELPNTSSVAE
FT                   FAVNWTLEESF"
     MTARTVLISG GGRGIGAATG RVMMQAGWNV SLGMRSPALP DWAEEGPGQV QACAYEATDP        60
     AAAERWVAEA RARFGGIDAV VANAGIMIRK DVIAAEDEEL ARLMEVHVAA PRRLAKAAWN       120
     DLAASGRGRV IIVSSLSGKR VKSAISSLYS VSKFAATGLA HALRHTGFEL GIRATAVCPG       180
     FVATDMGLPL TTRTAEELTD PADIGRAIRF LIELPNTSSV AEFAVNWTLE ESF              233
//

If you have problems or comments...

PBIL Back to PBIL home page