(data stored in ACNUC1104 zone)

EMBL: CP002026.PE385

CP002026.PE385       Location/Qualifiers
FT   CDS             391052..391342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK23758 gene product from transcript
FT                   GK23758-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87722"
FT                   /db_xref="UniProtKB/TrEMBL:D7A304"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87722.1"
FT                   /translation="MSRVPATLLAVIMLAASAAAPAFAQDAGTMPGNLNNLNQPVIPPG
FT                   NPDNLNPGADAPQPLTGELVPLPGPPPVGGAADLKLPDCAPPNCGTPQIMQ"
     MSRVPATLLA VIMLAASAAA PAFAQDAGTM PGNLNNLNQP VIPPGNPDNL NPGADAPQPL        60
     TGELVPLPGP PPVGGAADLK LPDCAPPNCG TPQIMQ                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page