(data stored in ACNUC1104 zone)

EMBL: CP002026.PE387

CP002026.PE387       Location/Qualifiers
FT   CDS             complement(392485..393450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0391"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: oan:Oant_2921 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; ThiJ/PfpI domain protein; SMART:
FT                   Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87724"
FT                   /db_xref="GOA:D7A306"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7A306"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADH87724.1"
FT                   /translation="MIFAHSDEPLDVTLLLFSGLSLLSLAATLDPMRGANRVLGRAAYR
FT                   WKLTSIDGQMPVASCGLPIPVDGAFDPSMQQDALIVVAAFDAVHHATPRILKSLRAGAT
FT                   RSKIVGGIESGSWLMGFAGLLDGRRATTHWEDLEDFAARFPNADVEPDRFVVDEPVFTT
FT                   GGATPALDCMLSLIRARNGYSAALDVASLYIYEEVRTGSDVQPIVSLGRIRQHEPRVAE
FT                   AIRIMETHIDRPLTIAAIARRVGVSTRGLETLFQKTVDVSPGVYYVTLRLNAARRLVLD
FT                   TNLPIADIAERTGFSAIASLSRAYRRQFGAPPSAARRTRS"
     MIFAHSDEPL DVTLLLFSGL SLLSLAATLD PMRGANRVLG RAAYRWKLTS IDGQMPVASC        60
     GLPIPVDGAF DPSMQQDALI VVAAFDAVHH ATPRILKSLR AGATRSKIVG GIESGSWLMG       120
     FAGLLDGRRA TTHWEDLEDF AARFPNADVE PDRFVVDEPV FTTGGATPAL DCMLSLIRAR       180
     NGYSAALDVA SLYIYEEVRT GSDVQPIVSL GRIRQHEPRV AEAIRIMETH IDRPLTIAAI       240
     ARRVGVSTRG LETLFQKTVD VSPGVYYVTL RLNAARRLVL DTNLPIADIA ERTGFSAIAS       300
     LSRAYRRQFG APPSAARRTR S                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page