(data stored in ACNUC1104 zone)

EMBL: CP002026.PE388

CP002026.PE388       Location/Qualifiers
FT   CDS             393555..394457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0392"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   sme:SMc01637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87725"
FT                   /db_xref="GOA:D7A307"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7A307"
FT                   /inference="protein motif:PFAM:PF05853"
FT                   /protein_id="ADH87725.1"
FT                   /translation="MPLSMNREVFITCAVTGAGDTVGRSSHVPVTPQQIAESAIDAAKA
FT                   GAAVVHCHVRDPETGAASRRRDLFREVTDRIRSAEVDVVLNLTAGMGGDLVFGSVEAPF
FT                   PVNAAGTDMAGATERVAHVAECLPEICTLDCGTMNFNLGDYVMTNTPSMLRAMARQMTA
FT                   LGVRPEIEAFDTGHLWFAKQLAEEGLIENPVLIQLCMGIPWGAPDDLNTFMAMVNNVPA
FT                   NWTFSAFSIGRNALAYPAAAVLAGGNVRVGLEDNLYAGKGQLATNAQLVEKAATVVTNM
FT                   GARILGPQEVREKLKLVKR"
     MPLSMNREVF ITCAVTGAGD TVGRSSHVPV TPQQIAESAI DAAKAGAAVV HCHVRDPETG        60
     AASRRRDLFR EVTDRIRSAE VDVVLNLTAG MGGDLVFGSV EAPFPVNAAG TDMAGATERV       120
     AHVAECLPEI CTLDCGTMNF NLGDYVMTNT PSMLRAMARQ MTALGVRPEI EAFDTGHLWF       180
     AKQLAEEGLI ENPVLIQLCM GIPWGAPDDL NTFMAMVNNV PANWTFSAFS IGRNALAYPA       240
     AAVLAGGNVR VGLEDNLYAG KGQLATNAQL VEKAATVVTN MGARILGPQE VREKLKLVKR       300
//

If you have problems or comments...

PBIL Back to PBIL home page