(data stored in ACNUC1104 zone)

EMBL: CP002026.PE389

CP002026.PE389       Location/Qualifiers
FT   CDS             394469..395980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0393"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein; KEGG:
FT                   rlg:Rleg_6430 3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87726"
FT                   /db_xref="GOA:D7A308"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR026578"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A308"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ADH87726.1"
FT                   /translation="MTSLAPISRAACIGGGVIGGGWVARFLLAGIDVKVFDPHPEAERI
FT                   VAEVLANAERAYGLLTSVPLPPRGRLTFCASVGEAVADAEWIQESVPERLDLKRRVLAE
FT                   IDAAAPADALIGSSTSGLLPSDLQEGLGHPERLFVAHPYNPVYLLPLAEIVGGKATSAA
FT                   TIARAKDALDAIGMKGVVIAREIEAFVGDRLLEALWREALWLIKDDICDVETLDDVIRY
FT                   SFGLRWAQMGLFQTYRIAGGEAGMRHFLAQFGPCLQWPWTKLTDVVDLDEALVEKIGAQ
FT                   SDAQAKGLSIRQLERIRDENLVGILQALKAGQGGEGWGAGKLLAEFEQRLRESAGHADA
FT                   VDIHAPLPLVETRVSPAWIDYNGHMTEHRYLQVFGDTTDALLRLIGADLAYVEGGHSYY
FT                   TVETHLRHLDEAHLGEALRATCQILSVDEKRIHIFHRLFAGAGNREVATAEQMLLHVDT
FT                   RAGRATPAPEIILARLRPIATAHAQLDAPEGAGRAVGQKRSMAAV"
     MTSLAPISRA ACIGGGVIGG GWVARFLLAG IDVKVFDPHP EAERIVAEVL ANAERAYGLL        60
     TSVPLPPRGR LTFCASVGEA VADAEWIQES VPERLDLKRR VLAEIDAAAP ADALIGSSTS       120
     GLLPSDLQEG LGHPERLFVA HPYNPVYLLP LAEIVGGKAT SAATIARAKD ALDAIGMKGV       180
     VIAREIEAFV GDRLLEALWR EALWLIKDDI CDVETLDDVI RYSFGLRWAQ MGLFQTYRIA       240
     GGEAGMRHFL AQFGPCLQWP WTKLTDVVDL DEALVEKIGA QSDAQAKGLS IRQLERIRDE       300
     NLVGILQALK AGQGGEGWGA GKLLAEFEQR LRESAGHADA VDIHAPLPLV ETRVSPAWID       360
     YNGHMTEHRY LQVFGDTTDA LLRLIGADLA YVEGGHSYYT VETHLRHLDE AHLGEALRAT       420
     CQILSVDEKR IHIFHRLFAG AGNREVATAE QMLLHVDTRA GRATPAPEII LARLRPIATA       480
     HAQLDAPEGA GRAVGQKRSM AAV                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page