(data stored in ACNUC1104 zone)

EMBL: CP002026.PE391

CP002026.PE391       Location/Qualifiers
FT   CDS             396967..397917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0395"
FT                   /product="molybdopterin dehydrogenase FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   azc:AZC_1401 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87728"
FT                   /db_xref="GOA:D7A310"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D7A310"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ADH87728.1"
FT                   /translation="MKPFTYERAASPAQAAAAAIQMPGAKFIAGGTNLLDLMKLQIETP
FT                   AHLIDVNGLALDTIEPTQEGGLRIGALVSNTDLAADARVRRDYGLLARALLAGASGQLR
FT                   NKATTAGNLLQRTRCPYFYDTDQPCNKRHPGSGCSAIGGVTRQLGVIGTSDACIATHPS
FT                   DMAVALRALDATVETVRADGATRRIPVAELHRLPGDTPHVETALEPGELITAVVLPAPV
FT                   GGTQIYRKVRDRASYAFALVSVGAVLQHDGTGRIAVGGIAPKPWRVEEAEAELANGARA
FT                   FTTRLLAGARPTRDNAFKVALVERTLAAVLNEARG"
     MKPFTYERAA SPAQAAAAAI QMPGAKFIAG GTNLLDLMKL QIETPAHLID VNGLALDTIE        60
     PTQEGGLRIG ALVSNTDLAA DARVRRDYGL LARALLAGAS GQLRNKATTA GNLLQRTRCP       120
     YFYDTDQPCN KRHPGSGCSA IGGVTRQLGV IGTSDACIAT HPSDMAVALR ALDATVETVR       180
     ADGATRRIPV AELHRLPGDT PHVETALEPG ELITAVVLPA PVGGTQIYRK VRDRASYAFA       240
     LVSVGAVLQH DGTGRIAVGG IAPKPWRVEE AEAELANGAR AFTTRLLAGA RPTRDNAFKV       300
     ALVERTLAAV LNEARG                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page