(data stored in ACNUC1104 zone)

EMBL: CP002026.PE392

CP002026.PE392       Location/Qualifiers
FT   CDS             397921..400131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0396"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: azc:AZC_1400 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87729"
FT                   /db_xref="GOA:D7A311"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D7A311"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ADH87729.1"
FT                   /translation="MKFDTPATTNPIDQMKVVGQPLDRIDGPLKTTGTAPYAYERHDVA
FT                   AAPAYGYVVGSAIAKGRIARMDVSAAQRAPGVLAVVTAENAGLLDKGKYNTAKLLGGPE
FT                   IEHYHQAVALVVAETFEQARAAAPLVKIDYATEAGSFDLHAARVAAFPPEENEITGPPE
FT                   THVGDFAGAFAQAPVTLDETYTTPDHSHAMMEPHATLAAWEGDKLTVWTSNQMIAWANG
FT                   DLAKTLRVPTEKVRVISPFIGGGFGGKLFLRADVVLAALGARAAGRPVKVALQRPLIAN
FT                   NTTHRPATIQRIRIGATREGVITAIGHESWSGDLEGGGPETAVNQTRLLYAGANRMTAM
FT                   RLAVLDLPEGNAMRAPGEAPGMMALEIAMDEMAEKLGIDPIEFRIRNDTQVDPEKPERP
FT                   FSARAFAECLRLGAERFGWDARNPRPGQWREGKWLVGIGMAAAFRNNLLMKSGARVRLD
FT                   GDGRVTVETDMTDIGTGSYTIIGQTAAEMMGVPIEKVTVRLGDSSFPVSAGSGGQFGAN
FT                   NATAGVYAACVKLREEVTQRLGFNSEDAVFADGQVRAGNRSVLLGAAAAEGDIIAEDAI
FT                   EYGDLDERYQQSTFGGHFVETTVDAYTGETRIRRMLAVCAAGRILNPKSARSQVIGAMT
FT                   MGAGAALMEELAVDTRRGFFVNHDLAGYEVPVHADIPHQEVIFLDETDPLSSPMKAKGV
FT                   GELGICGVGAAVANAVYNATGVRVRDYPITLDKYLDRLPDAA"
     MKFDTPATTN PIDQMKVVGQ PLDRIDGPLK TTGTAPYAYE RHDVAAAPAY GYVVGSAIAK        60
     GRIARMDVSA AQRAPGVLAV VTAENAGLLD KGKYNTAKLL GGPEIEHYHQ AVALVVAETF       120
     EQARAAAPLV KIDYATEAGS FDLHAARVAA FPPEENEITG PPETHVGDFA GAFAQAPVTL       180
     DETYTTPDHS HAMMEPHATL AAWEGDKLTV WTSNQMIAWA NGDLAKTLRV PTEKVRVISP       240
     FIGGGFGGKL FLRADVVLAA LGARAAGRPV KVALQRPLIA NNTTHRPATI QRIRIGATRE       300
     GVITAIGHES WSGDLEGGGP ETAVNQTRLL YAGANRMTAM RLAVLDLPEG NAMRAPGEAP       360
     GMMALEIAMD EMAEKLGIDP IEFRIRNDTQ VDPEKPERPF SARAFAECLR LGAERFGWDA       420
     RNPRPGQWRE GKWLVGIGMA AAFRNNLLMK SGARVRLDGD GRVTVETDMT DIGTGSYTII       480
     GQTAAEMMGV PIEKVTVRLG DSSFPVSAGS GGQFGANNAT AGVYAACVKL REEVTQRLGF       540
     NSEDAVFADG QVRAGNRSVL LGAAAAEGDI IAEDAIEYGD LDERYQQSTF GGHFVETTVD       600
     AYTGETRIRR MLAVCAAGRI LNPKSARSQV IGAMTMGAGA ALMEELAVDT RRGFFVNHDL       660
     AGYEVPVHAD IPHQEVIFLD ETDPLSSPMK AKGVGELGIC GVGAAVANAV YNATGVRVRD       720
     YPITLDKYLD RLPDAA                                                       736
//

If you have problems or comments...

PBIL Back to PBIL home page