(data stored in ACNUC1104 zone)

EMBL: CP002026.PE396

CP002026.PE396       Location/Qualifiers
FT   CDS             403949..404860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0400"
FT                   /product="nitrate ABC transporter, inner membrane subunit"
FT                   /note="KEGG: xau:Xaut_2503 nitrate ABC transporter, inner
FT                   membrane subunit; TIGRFAM: nitrate ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87733"
FT                   /db_xref="GOA:D7A315"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A315"
FT                   /inference="protein motif:TFAM:TIGR01183"
FT                   /protein_id="ADH87733.1"
FT                   /translation="MSLTALKSETTVPPKPAAGGKSGAKVVRLVFPARPAAAPGRFATL
FT                   GHSLAVTLVPPLVVLMLLLGLWELLCAGPGATLPPPSSIWQDSYDLIVDPFFVNGPQDI
FT                   GLGWRVLVSLQRVAIGFGLAAGVGILLGVLIGQSVWAMRGLDPIFQVLRTVPPLAWLPI
FT                   ALAAFRDSNPSAIFVIFITAIWPVIINTAVGVRNIPQDYRNVAQVLRLNPFEFFAKIML
FT                   PAAAPYIFTGLRIGVGLSWLAIVAAEMLTGGVGIGFFIWDAWNSSRLSDIIVALVYIGV
FT                   VGFVLDRLVAGIGAFVTRGTAA"
     MSLTALKSET TVPPKPAAGG KSGAKVVRLV FPARPAAAPG RFATLGHSLA VTLVPPLVVL        60
     MLLLGLWELL CAGPGATLPP PSSIWQDSYD LIVDPFFVNG PQDIGLGWRV LVSLQRVAIG       120
     FGLAAGVGIL LGVLIGQSVW AMRGLDPIFQ VLRTVPPLAW LPIALAAFRD SNPSAIFVIF       180
     ITAIWPVIIN TAVGVRNIPQ DYRNVAQVLR LNPFEFFAKI MLPAAAPYIF TGLRIGVGLS       240
     WLAIVAAEML TGGVGIGFFI WDAWNSSRLS DIIVALVYIG VVGFVLDRLV AGIGAFVTRG       300
     TAA                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page