(data stored in ACNUC1104 zone)

EMBL: CP002026.PE398

CP002026.PE398       Location/Qualifiers
FT   CDS             405676..406137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0402"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: azc:AZC_0683 putative
FT                   hemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87735"
FT                   /db_xref="GOA:D7A317"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:D7A317"
FT                   /inference="protein motif:PFAM:PF00042"
FT                   /protein_id="ADH87735.1"
FT                   /translation="MTPERIALVRESFAKVRPIADDAAALFYGRLFQIAPEVRPLFPAD
FT                   LTEQGRKLMTTLAVVVNSLDDLPALLPVVQRLGARHAGYGVTGEHFAPVGAALLWTLEK
FT                   GLGEGFTPEVRMAWTEAYHVLATVMIDALKSAAPPVQESPFGRIVGVQP"
     MTPERIALVR ESFAKVRPIA DDAAALFYGR LFQIAPEVRP LFPADLTEQG RKLMTTLAVV        60
     VNSLDDLPAL LPVVQRLGAR HAGYGVTGEH FAPVGAALLW TLEKGLGEGF TPEVRMAWTE       120
     AYHVLATVMI DALKSAAPPV QESPFGRIVG VQP                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page