(data stored in ACNUC1104 zone)

EMBL: CP002026.PE399

CP002026.PE399       Location/Qualifiers
FT   CDS             406134..407396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0403"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: azc:AZC_0682 putative nitrite
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87736"
FT                   /db_xref="GOA:D7A318"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="UniProtKB/TrEMBL:D7A318"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADH87736.1"
FT                   /translation="MNPAIRLPRERLLIIGNGMAAAKLCEELDSAAHGRFDVTVVGAEP
FT                   HLAYNRVLLSCLLAGEIGAPDIELHSAAWWRAKGVTVRTGCPVAAIDIEARHAVLADGT
FT                   VLGWDKLVFATGSQAIRLPVPGMELPGVMTFRDRADVEAILASASPGRRAVVIGGGLLG
FT                   LEAATGLAGAGIETAVIHLADRLMERQLDARAAGLLKRAVEARGIAVHLNASTQCIEGT
FT                   DRVEALRLADGRCLPADLVIVACGVRANAELARAAGIACQRGVLVDDGLATDMPGVYAL
FT                   GECAEHRGQVYGLVEPAYEQARVLAARLAGGSARYEGSVTATNLKVSGVKVFSAGDFMG
FT                   GADTQDIVLFDARAEHYRRLVLRPDAAGTRLVGAVLFGDTADGLYYLDLIRSGRDISAE
FT                   RADIAFGRPDLPLPNLAREAA"
     MNPAIRLPRE RLLIIGNGMA AAKLCEELDS AAHGRFDVTV VGAEPHLAYN RVLLSCLLAG        60
     EIGAPDIELH SAAWWRAKGV TVRTGCPVAA IDIEARHAVL ADGTVLGWDK LVFATGSQAI       120
     RLPVPGMELP GVMTFRDRAD VEAILASASP GRRAVVIGGG LLGLEAATGL AGAGIETAVI       180
     HLADRLMERQ LDARAAGLLK RAVEARGIAV HLNASTQCIE GTDRVEALRL ADGRCLPADL       240
     VIVACGVRAN AELARAAGIA CQRGVLVDDG LATDMPGVYA LGECAEHRGQ VYGLVEPAYE       300
     QARVLAARLA GGSARYEGSV TATNLKVSGV KVFSAGDFMG GADTQDIVLF DARAEHYRRL       360
     VLRPDAAGTR LVGAVLFGDT ADGLYYLDLI RSGRDISAER ADIAFGRPDL PLPNLAREAA       420
//

If you have problems or comments...

PBIL Back to PBIL home page