(data stored in ACNUC1104 zone)

EMBL: CP002026.PE4

CP002026.PE4         Location/Qualifiers
FT   CDS             2010..3509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0004"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   bbt:BBta_6611 site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87341"
FT                   /db_xref="GOA:D6ZZS7"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZS7"
FT                   /inference="protein motif:PFAM:PF01555"
FT                   /protein_id="ADH87341.1"
FT                   /translation="MTPETFLDGRVTLYCGDSRDALDLIEPNSVDNCVCDPPYALVSIG
FT                   KRFGKEGAAPAKGGVYQRASGGFMGQSWDTGEVAFDAKFWRKVFRALKPGGHVIAFGGT
FT                   RAYHRLAVAIEDAGFEIRDSIGDLISLDPMVRAFVDSLDEAQLDAFLRIADLIGFEGLL
FT                   AWVYGTGFPKSHDVSKAIDKMAGAERPVVGFDPVAAKRTSKFGTNSYGDFKGQNGDVTA
FT                   PATAAAAAWQGWGTALKPAWEPIVLARKPLIGTVAENVLEHGTGALNVDGCRVGDEVRT
FT                   AAFTSLAPCHGNALGAAGTAEACRGTQGEPKEYVGRHPANIIHDGTDEVVSAFPETESG
FT                   AGAVKRATAAGHQGNALGRESRPAGTPMISHGDSGSASRFFYSAKADADDRLGSKHPTV
FT                   KPVDLMQWLVRLVTAKGGTVLDPFAGTGTTGEAAWREGCNAVLIERNPPYQADIRRRMA
FT                   LCTAGSATRKRAARLARAEAEGKAPEFGPLFGGLTGPEAAE"
     MTPETFLDGR VTLYCGDSRD ALDLIEPNSV DNCVCDPPYA LVSIGKRFGK EGAAPAKGGV        60
     YQRASGGFMG QSWDTGEVAF DAKFWRKVFR ALKPGGHVIA FGGTRAYHRL AVAIEDAGFE       120
     IRDSIGDLIS LDPMVRAFVD SLDEAQLDAF LRIADLIGFE GLLAWVYGTG FPKSHDVSKA       180
     IDKMAGAERP VVGFDPVAAK RTSKFGTNSY GDFKGQNGDV TAPATAAAAA WQGWGTALKP       240
     AWEPIVLARK PLIGTVAENV LEHGTGALNV DGCRVGDEVR TAAFTSLAPC HGNALGAAGT       300
     AEACRGTQGE PKEYVGRHPA NIIHDGTDEV VSAFPETESG AGAVKRATAA GHQGNALGRE       360
     SRPAGTPMIS HGDSGSASRF FYSAKADADD RLGSKHPTVK PVDLMQWLVR LVTAKGGTVL       420
     DPFAGTGTTG EAAWREGCNA VLIERNPPYQ ADIRRRMALC TAGSATRKRA ARLARAEAEG       480
     KAPEFGPLFG GLTGPEAAE                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page