(data stored in ACNUC1104 zone)

EMBL: CP002026.PE402

CP002026.PE402       Location/Qualifiers
FT   CDS             410766..413477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0406"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molybdopterin
FT                   oxidoreductase Fe4S4 region; molydopterin
FT                   dinucleotide-binding region; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; KEGG: xau:Xaut_2497
FT                   molybdopterin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87739"
FT                   /db_xref="GOA:D7A321"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:D7A321"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ADH87739.1"
FT                   /translation="MNAPVPPPLGEVVAAASSGRPAVRTTCPYCGVGCGVLATLDGQGG
FT                   ALIAGDPEHPANFGRLCSKGSALGETLGLETRLLHPMAREGDGPLLRIGWGTALDRIAS
FT                   AFRDTIDRHGPDSVALYLSGQLLTEDYYAANKLAKGFLGTANVDTNSRLCMASSVAGHR
FT                   RAFGSDTVPGCYEDLDEADLVVLVGSNAAWCHPVLFRRIEAARARRGTRVVVIDPRRTA
FT                   TGDEADLFLPVRAGMDSIVFSGLLVRLAEHGALDDAYIAAHTSGFEATLAAARELAPDV
FT                   ATAARAAGVEAEALEEFYRLFERTERVVTCYSQGVNQSAQGTDKVNAIINCHLATGRIG
FT                   RPGMGPFSLTGQPNAMGGREVGGLANQLAAHMDFSPGSVDRVGRFWQAPHMATREGLKA
FT                   VALFDAIAAGKVKALWVMGTNPAVSLPRADGVREALRGLDFLAVSDNVAANDTLGCRPH
FT                   LVLPALAWGEKDGTVTNSERRISRQRAFLSPPGEAKADWWAIAQVGKRLGHAAAFKWRS
FT                   AAEVFREHAALSAFENGGTRDFDLSGLAGLDDAAFDALAPVQWPVRGAGESKRFFAEGG
FT                   FYTSDRKACFVPPRRPELARATSEAYPFLLNTGRIRDQWHTMTRSGLSPRLGAHLPVPF
FT                   AEINAEDAARLGITDGAMVRVASAHGALAVEARLAAGQPRGTVFVPIHWSEATSSCGRL
FT                   GALVAGDTDPASGQPEAKATPVTLVPVEMPFRGFVLSRQAMTPPPAQWWARATLDGAIA
FT                   YILADDRPPQDWLHAWLGDETGAVRLDDAGAGRYRFADFDEAGRIRLVAFVERSDRRLD
FT                   WSGALSWFADEERDIARRGQVLSGRAESGGACGPVICACHGVAQDSIEAFIAGNPAAGL
FT                   AGIGAALKAGTNCGSCIPELRRLLARTEPALG"
     MNAPVPPPLG EVVAAASSGR PAVRTTCPYC GVGCGVLATL DGQGGALIAG DPEHPANFGR        60
     LCSKGSALGE TLGLETRLLH PMAREGDGPL LRIGWGTALD RIASAFRDTI DRHGPDSVAL       120
     YLSGQLLTED YYAANKLAKG FLGTANVDTN SRLCMASSVA GHRRAFGSDT VPGCYEDLDE       180
     ADLVVLVGSN AAWCHPVLFR RIEAARARRG TRVVVIDPRR TATGDEADLF LPVRAGMDSI       240
     VFSGLLVRLA EHGALDDAYI AAHTSGFEAT LAAARELAPD VATAARAAGV EAEALEEFYR       300
     LFERTERVVT CYSQGVNQSA QGTDKVNAII NCHLATGRIG RPGMGPFSLT GQPNAMGGRE       360
     VGGLANQLAA HMDFSPGSVD RVGRFWQAPH MATREGLKAV ALFDAIAAGK VKALWVMGTN       420
     PAVSLPRADG VREALRGLDF LAVSDNVAAN DTLGCRPHLV LPALAWGEKD GTVTNSERRI       480
     SRQRAFLSPP GEAKADWWAI AQVGKRLGHA AAFKWRSAAE VFREHAALSA FENGGTRDFD       540
     LSGLAGLDDA AFDALAPVQW PVRGAGESKR FFAEGGFYTS DRKACFVPPR RPELARATSE       600
     AYPFLLNTGR IRDQWHTMTR SGLSPRLGAH LPVPFAEINA EDAARLGITD GAMVRVASAH       660
     GALAVEARLA AGQPRGTVFV PIHWSEATSS CGRLGALVAG DTDPASGQPE AKATPVTLVP       720
     VEMPFRGFVL SRQAMTPPPA QWWARATLDG AIAYILADDR PPQDWLHAWL GDETGAVRLD       780
     DAGAGRYRFA DFDEAGRIRL VAFVERSDRR LDWSGALSWF ADEERDIARR GQVLSGRAES       840
     GGACGPVICA CHGVAQDSIE AFIAGNPAAG LAGIGAALKA GTNCGSCIPE LRRLLARTEP       900
     ALG                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page