(data stored in ACNUC1104 zone)

EMBL: CP002026.PE404

CP002026.PE404       Location/Qualifiers
FT   CDS             414860..415315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0408"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="KEGG: pde:Pden_1690 BadM/Rrf2 family transcriptional
FT                   regulator; TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87741"
FT                   /db_xref="GOA:D7A323"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A323"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ADH87741.1"
FT                   /translation="MRLTRYSDYAMRVMLYLAARGDRPCSISEMAAAYGISQNHLMKVM
FT                   NDLGRAGYVASTRGRNGGFRLARPANEIVVGDLLRHTEDDLDLVDCPRCVLSRGCGLSS
FT                   VLDEALMAFLAVLDRYTLADLIDRRQGFQSLLLSLDSGMGRIQPGLA"
     MRLTRYSDYA MRVMLYLAAR GDRPCSISEM AAAYGISQNH LMKVMNDLGR AGYVASTRGR        60
     NGGFRLARPA NEIVVGDLLR HTEDDLDLVD CPRCVLSRGC GLSSVLDEAL MAFLAVLDRY       120
     TLADLIDRRQ GFQSLLLSLD SGMGRIQPGL A                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page