(data stored in ACNUC1104 zone)

EMBL: CP002026.PE405

CP002026.PE405       Location/Qualifiers
FT   CDS             415315..416478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0409"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="KEGG: mlo:mll8143 hypothetical protein; PFAM: HPP
FT                   family protein; CBS domain containing protein; SMART: CBS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87742"
FT                   /db_xref="GOA:D7A324"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:D7A324"
FT                   /inference="protein motif:PFAM:PF04982"
FT                   /protein_id="ADH87742.1"
FT                   /translation="MAVSTTALVLVSSAGLLVACVAGARPRPSPLAMHLEWALSAFARI
FT                   RLFRPILAGATLRDRILACLGALVGIALTAFVSAVAAGNVTDLLWIVPPMGASAVLLFA
FT                   VPASPMAQPWPAIGGNVISALIGIAVAHFMPLSALSAGIAVASAIAAMSLLRCLHPPGG
FT                   AAALVGLFAGASSSYWFPLMPVGVNAVILTASAWVYHRMSGHTYPHAPAAPAAAPKPTQ
FT                   ELPWTFSRSDVASALEEMGETFDIDTADLETLLRTIEQRALARSYKQLTCRELMSTGLI
FT                   SVAASAAPEEARAKLVASDVRRLPVLDTDGRIVGAVGLRDLIRPAATVRALMTPAATAT
FT                   PEAHAIDLLGRYAHDRVHAVFVVDEDRKPIGVVTEADWLAVLTRGLE"
     MAVSTTALVL VSSAGLLVAC VAGARPRPSP LAMHLEWALS AFARIRLFRP ILAGATLRDR        60
     ILACLGALVG IALTAFVSAV AAGNVTDLLW IVPPMGASAV LLFAVPASPM AQPWPAIGGN       120
     VISALIGIAV AHFMPLSALS AGIAVASAIA AMSLLRCLHP PGGAAALVGL FAGASSSYWF       180
     PLMPVGVNAV ILTASAWVYH RMSGHTYPHA PAAPAAAPKP TQELPWTFSR SDVASALEEM       240
     GETFDIDTAD LETLLRTIEQ RALARSYKQL TCRELMSTGL ISVAASAAPE EARAKLVASD       300
     VRRLPVLDTD GRIVGAVGLR DLIRPAATVR ALMTPAATAT PEAHAIDLLG RYAHDRVHAV       360
     FVVDEDRKPI GVVTEADWLA VLTRGLE                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page