(data stored in ACNUC1104 zone)

EMBL: CP002026.PE407

CP002026.PE407       Location/Qualifiers
FT   CDS             416995..417441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0411"
FT                   /product="protein of unknown function DUF296"
FT                   /note="PFAM: protein of unknown function DUF296; KEGG:
FT                   sme:SM_b20067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87744"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="InterPro:IPR025707"
FT                   /db_xref="UniProtKB/TrEMBL:D7A326"
FT                   /inference="protein motif:PFAM:PF03479"
FT                   /protein_id="ADH87744.1"
FT                   /translation="MKSKLLGEGEGGRLFALVLDPGEEAFAAIRDFAAKEGISAASVTA
FT                   IGAFSRATVGWFDFDTRDYRRIPVEEQCEVLSALGDIARDDDGKASLHLHAVLGLSDGS
FT                   TRGGHLLDGIVRPTLEVMITETPAHLHRRKRPGLGISLIDLGSG"
     MKSKLLGEGE GGRLFALVLD PGEEAFAAIR DFAAKEGISA ASVTAIGAFS RATVGWFDFD        60
     TRDYRRIPVE EQCEVLSALG DIARDDDGKA SLHLHAVLGL SDGSTRGGHL LDGIVRPTLE       120
     VMITETPAHL HRRKRPGLGI SLIDLGSG                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page