(data stored in ACNUC1104 zone)

EMBL: CP002026.PE408

CP002026.PE408       Location/Qualifiers
FT   CDS             417458..418441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0412"
FT                   /product="Glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="KEGG: rpd:RPD_1383 glutaminase; PFAM: Glutaminase,
FT                   core"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87745"
FT                   /db_xref="GOA:D7A327"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:D7A327"
FT                   /inference="protein motif:PRIAM:3.5.1.2"
FT                   /protein_id="ADH87745.1"
FT                   /translation="MHGPDAVIPAIPQPKVTNPVPDLERIVSDIAEEMRARPDRGEVAT
FT                   YIPELARADPNAFGIAVIAADGQVAVGGDADVPFSIQSVSKVFTLTLALGKIGNLLWKR
FT                   VGREPSGSPFNSIVQLEAEHGIPRNPFINAGAIAVTDVILSGHQPREALGEILRFMHFL
FT                   AEDSSIGIDEAVAASEQRTGFRNRALANYMKSFDVLENPVDYTLGVYFHHCAIAMSCRQ
FT                   LAMAARFLAHGGRNPSTGFSVVSAERARRINAIMLTCGHYDGSGEFAYRVGLPGKSGVG
FT                   GGILAIAPGKASIAVWSPGLDASGNSHLGRIALEALTQRLGWSVFG"
     MHGPDAVIPA IPQPKVTNPV PDLERIVSDI AEEMRARPDR GEVATYIPEL ARADPNAFGI        60
     AVIAADGQVA VGGDADVPFS IQSVSKVFTL TLALGKIGNL LWKRVGREPS GSPFNSIVQL       120
     EAEHGIPRNP FINAGAIAVT DVILSGHQPR EALGEILRFM HFLAEDSSIG IDEAVAASEQ       180
     RTGFRNRALA NYMKSFDVLE NPVDYTLGVY FHHCAIAMSC RQLAMAARFL AHGGRNPSTG       240
     FSVVSAERAR RINAIMLTCG HYDGSGEFAY RVGLPGKSGV GGGILAIAPG KASIAVWSPG       300
     LDASGNSHLG RIALEALTQR LGWSVFG                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page