(data stored in ACNUC1104 zone)

EMBL: CP002026.PE410

CP002026.PE410       Location/Qualifiers
FT   CDS             419202..420236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0414"
FT                   /product="Glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="KEGG: met:M446_4572 glutamate--ammonia ligase; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87747"
FT                   /db_xref="GOA:D7A329"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D7A329"
FT                   /inference="protein motif:PRIAM:6.3.1.2"
FT                   /protein_id="ADH87747.1"
FT                   /translation="MTKYKLEYIWLDGYKPTPNLRGKTQIKEFDHFPSLEELPLWGFDG
FT                   SSTEQAEGRSSDCVLKPVAIYPDPARKNGALVMCEVMMPDGVTPHATNARATILDDEGA
FT                   WFGFEQEYFFYKDGRPLGFPEHGYPAPQGPYYTGVGFKNVGDIAREIVEEHLELCLEAG
FT                   INHEGINAEVAKGQWEFQIFGKGSKKAADEVWMARYLLLRLTEKYGVDIEFHCKPLGDT
FT                   DWNGSGMHCNFSTKFMREVGGKDYFEALMAAFAKNLDDHIAVYGPDNHMRLTGKHETAP
FT                   WNKFSYGVADRGASIRVPHSFIRNDYKGYLEDRRPNSQGDPYQIASQVLKTISEVDTKA
FT                   AAAA"
     MTKYKLEYIW LDGYKPTPNL RGKTQIKEFD HFPSLEELPL WGFDGSSTEQ AEGRSSDCVL        60
     KPVAIYPDPA RKNGALVMCE VMMPDGVTPH ATNARATILD DEGAWFGFEQ EYFFYKDGRP       120
     LGFPEHGYPA PQGPYYTGVG FKNVGDIARE IVEEHLELCL EAGINHEGIN AEVAKGQWEF       180
     QIFGKGSKKA ADEVWMARYL LLRLTEKYGV DIEFHCKPLG DTDWNGSGMH CNFSTKFMRE       240
     VGGKDYFEAL MAAFAKNLDD HIAVYGPDNH MRLTGKHETA PWNKFSYGVA DRGASIRVPH       300
     SFIRNDYKGY LEDRRPNSQG DPYQIASQVL KTISEVDTKA AAAA                        344
//

If you have problems or comments...

PBIL Back to PBIL home page