(data stored in ACNUC1104 zone)

EMBL: CP002026.PE411

CP002026.PE411       Location/Qualifiers
FT   CDS             complement(420520..421950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0415"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   bpt:Bpet3488 putative membrane-associated phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87748"
FT                   /db_xref="GOA:D7A330"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D7A330"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADH87748.1"
FT                   /translation="MLRFLSEYWPHITLVTSAAIGVVAAIHAAMTKDDVRAAIGWVGVI
FT                   LLSPFVGAFLYLVAGINRIRQSAAGRRRASQDRRRHHERPPIAIALSPSLSAMKRLGDR
FT                   VAAFPLTTGNAVELLDSGDAAYPAMLDAIRAAKRHVALSSYIFDNDPVGVQFADALIEA
FT                   HKRGVAVRVLIDAIGARYSRPSIVGRLMEGGVTVDLFMGNLIGLRLPYANLRSHRKMLI
FT                   VDGGLAFTGGMNIRAQFMAAFGGDDPARDTHFRVEGPAVEQLLTVFSQDWSFTTDEFLD
FT                   GPAWAEAPQGTHGPVAVRVVPSGPDRNLASAHNMIMGALAVAQSRVHVCSPYFLPDQQL
FT                   IGALTVAGRRGVEVDIVIPSANNLKLVDYAMTAQLDQVIAGECRVWRAEGMFDHSKLMA
FT                   VDGCWAYVGSSNLDPRSLRLNFELDLELYDPTIATAIETRVAAMMAASRPETLGTLARR
FT                   PFLEKLRNRAIWLASPYL"
     MLRFLSEYWP HITLVTSAAI GVVAAIHAAM TKDDVRAAIG WVGVILLSPF VGAFLYLVAG        60
     INRIRQSAAG RRRASQDRRR HHERPPIAIA LSPSLSAMKR LGDRVAAFPL TTGNAVELLD       120
     SGDAAYPAML DAIRAAKRHV ALSSYIFDND PVGVQFADAL IEAHKRGVAV RVLIDAIGAR       180
     YSRPSIVGRL MEGGVTVDLF MGNLIGLRLP YANLRSHRKM LIVDGGLAFT GGMNIRAQFM       240
     AAFGGDDPAR DTHFRVEGPA VEQLLTVFSQ DWSFTTDEFL DGPAWAEAPQ GTHGPVAVRV       300
     VPSGPDRNLA SAHNMIMGAL AVAQSRVHVC SPYFLPDQQL IGALTVAGRR GVEVDIVIPS       360
     ANNLKLVDYA MTAQLDQVIA GECRVWRAEG MFDHSKLMAV DGCWAYVGSS NLDPRSLRLN       420
     FELDLELYDP TIATAIETRV AAMMAASRPE TLGTLARRPF LEKLRNRAIW LASPYL           476
//

If you have problems or comments...

PBIL Back to PBIL home page