(data stored in ACNUC1104 zone)

EMBL: CP002026.PE412

CP002026.PE412       Location/Qualifiers
FT   CDS             complement(422097..424538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0416"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="SMART: peptidase S16 lon domain protein; AAA ATPase;
FT                   TIGRFAM: ATP-dependent protease La; KEGG: msl:Msil_3172
FT                   ATP-dependent protease La; PFAM: peptidase S16 lon domain
FT                   protein; AAA ATPase central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87749"
FT                   /db_xref="GOA:D7A331"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:D7A331"
FT                   /inference="protein motif:TFAM:TIGR00763"
FT                   /protein_id="ADH87749.1"
FT                   /translation="MTHPDFERFDPVRMADAGGNNGASGATNGNVPADQLIVLPVRNFV
FT                   LFPGVVLPLSVGRAASIAAAQQAVREGRPIGILMQRDASVEEPSPTDLHRMGVVANILR
FT                   YVTAPDGTHHLVLQGEQRFHVDEFVREKPFVTARVKRLEESEERSSEIEARFVHLQGQA
FT                   TEALELLPQVPAELVAAVRGSNSPAGLADLVAAYIDISADEKQELLETVDIVARMNKVS
FT                   RLLAHRIEVLRLSQEISKQTKASLDERQREVLLREQMAAIQKQLGEDDGNSQDIADLEK
FT                   AITDAGMPEDVEQMARKELGRLRRMQDASAEYGMVRTYLDWLIALPWKLPETAPIDIAE
FT                   ARKILDEDHFGLDKIKRRIVEYLAVRKLAPGGKAPILCFAGPPGVGKTSLGQSIARAMG
FT                   RKFVRVSLGGVHDEAEIRGHRRTYVGALPGNIIQGIRKAGTRDCVMMLDEIDKMGSGIQ
FT                   GDPSAAMLEVLDPEQNGTFRDNYLGVPFDLSRVVFIATANMLDTIPGPLRDRMEIIQLT
FT                   GYTDTEKLQIAKRYLVRRQLEANGVKPEQVEVDDEALKAIIRAYTREAGVRNLEREVGR
FT                   AVRHVAVGIAEGSVSHARISVDTLPEMLGPPIFEDEVALRVSVPGVATGLAWTPVGGDI
FT                   LFIEATRVPGRGGLILTGQLGDVMKESAQAAWSLVKSRAEELGIDPELFAKNDVHVHVP
FT                   AGATPKDGPSAGVAMFTALVSLLTGRTVRKDTAMTGEISLRGLVLPVGGIKEKVVAAAR
FT                   AGLTRVMLPARNRRDYEDIPQDARDRLEFVWLERVDEAMANALEPRESPDQPALPLKAA
FT                   S"
     MTHPDFERFD PVRMADAGGN NGASGATNGN VPADQLIVLP VRNFVLFPGV VLPLSVGRAA        60
     SIAAAQQAVR EGRPIGILMQ RDASVEEPSP TDLHRMGVVA NILRYVTAPD GTHHLVLQGE       120
     QRFHVDEFVR EKPFVTARVK RLEESEERSS EIEARFVHLQ GQATEALELL PQVPAELVAA       180
     VRGSNSPAGL ADLVAAYIDI SADEKQELLE TVDIVARMNK VSRLLAHRIE VLRLSQEISK       240
     QTKASLDERQ REVLLREQMA AIQKQLGEDD GNSQDIADLE KAITDAGMPE DVEQMARKEL       300
     GRLRRMQDAS AEYGMVRTYL DWLIALPWKL PETAPIDIAE ARKILDEDHF GLDKIKRRIV       360
     EYLAVRKLAP GGKAPILCFA GPPGVGKTSL GQSIARAMGR KFVRVSLGGV HDEAEIRGHR       420
     RTYVGALPGN IIQGIRKAGT RDCVMMLDEI DKMGSGIQGD PSAAMLEVLD PEQNGTFRDN       480
     YLGVPFDLSR VVFIATANML DTIPGPLRDR MEIIQLTGYT DTEKLQIAKR YLVRRQLEAN       540
     GVKPEQVEVD DEALKAIIRA YTREAGVRNL EREVGRAVRH VAVGIAEGSV SHARISVDTL       600
     PEMLGPPIFE DEVALRVSVP GVATGLAWTP VGGDILFIEA TRVPGRGGLI LTGQLGDVMK       660
     ESAQAAWSLV KSRAEELGID PELFAKNDVH VHVPAGATPK DGPSAGVAMF TALVSLLTGR       720
     TVRKDTAMTG EISLRGLVLP VGGIKEKVVA AARAGLTRVM LPARNRRDYE DIPQDARDRL       780
     EFVWLERVDE AMANALEPRE SPDQPALPLK AAS                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page