(data stored in ACNUC1104 zone)

EMBL: CP002026.PE414

CP002026.PE414       Location/Qualifiers
FT   CDS             complement(425089..426006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0418"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: acr:Acry_2830 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87751"
FT                   /db_xref="GOA:D7A333"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A333"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH87751.1"
FT                   /translation="MELRHLQHFIAVAEEQHFTRAAQRANIVQSALSSSIRALEEELDA
FT                   RLFLRTTRQVRLTAAGEAFLEKARRVLDAVREAREAVSSAAALERGTLDIGAVPSLPAF
FT                   IDLPALLAAFHALYPGIEVRLSQGGSEPLTEKLRAGTLDLAILPLCEPVPDIAASVVAC
FT                   EGLVLVCAPAHPLAGRTEVTLAELAGEPFVDFQPGWGTRRLVDKGFGQAGLERRIAFEV
FT                   SDLDSLLALVARGLGVALVPETVAEARRDMLAVVDIAGPDLCWELVVAHLAPGRGGMSA
FT                   LDEAPRAFLDLMLSRAEPAKTQAA"
     MELRHLQHFI AVAEEQHFTR AAQRANIVQS ALSSSIRALE EELDARLFLR TTRQVRLTAA        60
     GEAFLEKARR VLDAVREARE AVSSAAALER GTLDIGAVPS LPAFIDLPAL LAAFHALYPG       120
     IEVRLSQGGS EPLTEKLRAG TLDLAILPLC EPVPDIAASV VACEGLVLVC APAHPLAGRT       180
     EVTLAELAGE PFVDFQPGWG TRRLVDKGFG QAGLERRIAF EVSDLDSLLA LVARGLGVAL       240
     VPETVAEARR DMLAVVDIAG PDLCWELVVA HLAPGRGGMS ALDEAPRAFL DLMLSRAEPA       300
     KTQAA                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page