(data stored in ACNUC1104 zone)

EMBL: CP002026.PE415

CP002026.PE415       Location/Qualifiers
FT   CDS             426156..427037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0419"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="KEGG: rpc:RPC_1857 6-phosphogluconate dehydrogenase,
FT                   NAD-binding; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87752"
FT                   /db_xref="GOA:D7A334"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A334"
FT                   /inference="protein motif:PRIAM:1.1.1.31"
FT                   /protein_id="ADH87752.1"
FT                   /translation="MKVGFIGLGSMGAGMARNLLKAGHEVTVFNRSPAKAAPLVEAGAV
FT                   AASSVAEACKGEAVITMLADDAAVSSVAEGEGGILASLAPGALHVSASTISVALSEKLT
FT                   AAHAEAGQLYAAAPVFGRPEVAAAGELFVAAAGPADTLTLAQPLFDAIGRQTFVFSDTP
FT                   SKANLVKLSGNFLIACVIETLGEALALVGKGGVDQKQYLDFLTSTLFGAPVYRNYGNLI
FT                   VDTTPRPVGFAAPLGLKDMRLALAAAEELRVPLPVGSLLRDRFLTLLANGGEGQDWSAI
FT                   GRLAAKDAGGVV"
     MKVGFIGLGS MGAGMARNLL KAGHEVTVFN RSPAKAAPLV EAGAVAASSV AEACKGEAVI        60
     TMLADDAAVS SVAEGEGGIL ASLAPGALHV SASTISVALS EKLTAAHAEA GQLYAAAPVF       120
     GRPEVAAAGE LFVAAAGPAD TLTLAQPLFD AIGRQTFVFS DTPSKANLVK LSGNFLIACV       180
     IETLGEALAL VGKGGVDQKQ YLDFLTSTLF GAPVYRNYGN LIVDTTPRPV GFAAPLGLKD       240
     MRLALAAAEE LRVPLPVGSL LRDRFLTLLA NGGEGQDWSA IGRLAAKDAG GVV              293
//

If you have problems or comments...

PBIL Back to PBIL home page