(data stored in ACNUC1104 zone)

EMBL: CP002026.PE417

CP002026.PE417       Location/Qualifiers
FT   CDS             428311..429327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azc:AZC_0718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87754"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:D7A336"
FT                   /inference="similar to AA sequence:KEGG:AZC_0718"
FT                   /protein_id="ADH87754.1"
FT                   /translation="MRLIGSFLIGSAGFVGVAVAVAWVSNASLPTPADAARADLPPFRM
FT                   APAAPETASAVVDEPSARPARTVMDVRNFYAAGEIPQPSNWLFDPAVMPIRPAVVAAVP
FT                   VPAPTAEPTVETVSAVPLPAANPLAAGRVMAGNEPEDALTFAPRPPKKPKLDAEIAALP
FT                   PPMEEDVAPDEPAPAPAVTEAPKDELRYPTREDKFAVYDIRAKKLYLPSGKKLEAHSGY
FT                   GAKMDNVRYVHVRMEGVTPPNRYSLKMREALFHGTEAVRMTPVGDGKMYGRNGFLLHPY
FT                   LLGPRGDSNGCVSVADYDAFLAAFKRGEVQELVVVESMPGSGDTLNPLLSWLTGKRS"
     MRLIGSFLIG SAGFVGVAVA VAWVSNASLP TPADAARADL PPFRMAPAAP ETASAVVDEP        60
     SARPARTVMD VRNFYAAGEI PQPSNWLFDP AVMPIRPAVV AAVPVPAPTA EPTVETVSAV       120
     PLPAANPLAA GRVMAGNEPE DALTFAPRPP KKPKLDAEIA ALPPPMEEDV APDEPAPAPA       180
     VTEAPKDELR YPTREDKFAV YDIRAKKLYL PSGKKLEAHS GYGAKMDNVR YVHVRMEGVT       240
     PPNRYSLKMR EALFHGTEAV RMTPVGDGKM YGRNGFLLHP YLLGPRGDSN GCVSVADYDA       300
     FLAAFKRGEV QELVVVESMP GSGDTLNPLL SWLTGKRS                               338
//

If you have problems or comments...

PBIL Back to PBIL home page