(data stored in ACNUC1104 zone)

EMBL: CP002026.PE418

CP002026.PE418       Location/Qualifiers
FT   CDS             429371..430633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0422"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="KEGG: mno:Mnod_5869 glycine
FT                   hydroxymethyltransferase; PFAM: glycine
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87755"
FT                   /db_xref="GOA:D7A337"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D7A337"
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /protein_id="ADH87755.1"
FT                   /translation="MSTLHAGYFTEGLDADPELAAALRGELKRQQDGIELIASENIVSR
FT                   LVLEAQGSVLTNKTVEGLPYARYYGGAEFADAIEALAVERAKKLFNCRFANVQPHSGSN
FT                   ANAGVFLGLLKLGDTILSMNTAAGGHISHGHPATLTGRDYRIVPYGVSRETERIELDEL
FT                   RTLALDHAPKLIVAGGSAYPPAIDFAGMRAIADEVGALFMVDMAHFAGLVATGLYPHPF
FT                   PHAHVVTSTTYKSLRGARGGIVLWNDASLNDRINYGIFPGVQGSVMMHAVAGKAACFGE
FT                   ALKPEFHAYNEAVLANARAMAAALATEGLRIVGGGTDCGLMLVDLSPLGVTGDIAAKAL
FT                   EKAGLAVNKNLVPFDPRPPEAPSGLRLSSNAGTARGFGIAEFETIAGWIARVVKAPADA
FT                   AAIAAVRAQVTSLCASFPIYA"
     MSTLHAGYFT EGLDADPELA AALRGELKRQ QDGIELIASE NIVSRLVLEA QGSVLTNKTV        60
     EGLPYARYYG GAEFADAIEA LAVERAKKLF NCRFANVQPH SGSNANAGVF LGLLKLGDTI       120
     LSMNTAAGGH ISHGHPATLT GRDYRIVPYG VSRETERIEL DELRTLALDH APKLIVAGGS       180
     AYPPAIDFAG MRAIADEVGA LFMVDMAHFA GLVATGLYPH PFPHAHVVTS TTYKSLRGAR       240
     GGIVLWNDAS LNDRINYGIF PGVQGSVMMH AVAGKAACFG EALKPEFHAY NEAVLANARA       300
     MAAALATEGL RIVGGGTDCG LMLVDLSPLG VTGDIAAKAL EKAGLAVNKN LVPFDPRPPE       360
     APSGLRLSSN AGTARGFGIA EFETIAGWIA RVVKAPADAA AIAAVRAQVT SLCASFPIYA       420
//

If you have problems or comments...

PBIL Back to PBIL home page