(data stored in ACNUC1104 zone)

EMBL: CP002026.PE422

CP002026.PE422       Location/Qualifiers
FT   CDS             433785..435809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0426"
FT                   /product="transketolase"
FT                   /note="KEGG: rsp:RSP_3268 transketolase; TIGRFAM:
FT                   transketolase; PFAM: Transketolase domain protein;
FT                   Transketolase central region"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87759"
FT                   /db_xref="GOA:D7A341"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D7A341"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ADH87759.1"
FT                   /translation="MLTRNAPTSQRPPQDLPEVLHDDMANALRALAMDAVEQAKSGHPG
FT                   MPMGMADVATALFSRFVKIDPTRPDWYDRDRVVLSAGHGSMLLYAVNHLLGYADMGTDQ
FT                   LRRFRQLGAVTAGHPEHGHTLGVETTTGPLGQGLATAVGMALAERMLNARFGDDLVDHY
FT                   TYVIAGDGCLMEGISHEAIDLAGHLKLGKLILLWDDNGISIDGRTTLSTSTDQLARFEA
FT                   AGWDVMRVDGHAYHAVTDAIAEARGTERPTLIACRTTIGFGAPTKAGTEGAHGAPLGPD
FT                   EIAGARARLGWSHPPFEVPDDVREAWAHTAARGRTAREAWERRLSGSGRRAAFEAAMEG
FT                   ELPADFDEKLDAYKRELSQSAPKVATRKASEMALGVINAETELTVGGSADLTHSNLTYT
FT                   KGLMPVTPGNFAGRYLHYGIREHAMAAVMNGLALHRGTIPYGGTFLVFSDYARGAMRLS
FT                   ALMGQRVVYVLTHDSIGLGEDGPTHQPVEHLAMLRATPNLHVFRPADAVETLEAWQLAL
FT                   HAERTPSVLALSRQNLPTFRTTHSEENLTGYGAYVARKPERRRDVTLLATGSEVELAFK
FT                   AADMLALRGVDAAVVSMPCWELFEKQSADYRRAVLGTAPRVAVEAAARFGWDRWIGERG
FT                   RFVGMEGFGASAPAADLYRYFNITPEAVVAAACDLITCA"
     MLTRNAPTSQ RPPQDLPEVL HDDMANALRA LAMDAVEQAK SGHPGMPMGM ADVATALFSR        60
     FVKIDPTRPD WYDRDRVVLS AGHGSMLLYA VNHLLGYADM GTDQLRRFRQ LGAVTAGHPE       120
     HGHTLGVETT TGPLGQGLAT AVGMALAERM LNARFGDDLV DHYTYVIAGD GCLMEGISHE       180
     AIDLAGHLKL GKLILLWDDN GISIDGRTTL STSTDQLARF EAAGWDVMRV DGHAYHAVTD       240
     AIAEARGTER PTLIACRTTI GFGAPTKAGT EGAHGAPLGP DEIAGARARL GWSHPPFEVP       300
     DDVREAWAHT AARGRTAREA WERRLSGSGR RAAFEAAMEG ELPADFDEKL DAYKRELSQS       360
     APKVATRKAS EMALGVINAE TELTVGGSAD LTHSNLTYTK GLMPVTPGNF AGRYLHYGIR       420
     EHAMAAVMNG LALHRGTIPY GGTFLVFSDY ARGAMRLSAL MGQRVVYVLT HDSIGLGEDG       480
     PTHQPVEHLA MLRATPNLHV FRPADAVETL EAWQLALHAE RTPSVLALSR QNLPTFRTTH       540
     SEENLTGYGA YVARKPERRR DVTLLATGSE VELAFKAADM LALRGVDAAV VSMPCWELFE       600
     KQSADYRRAV LGTAPRVAVE AAARFGWDRW IGERGRFVGM EGFGASAPAA DLYRYFNITP       660
     EAVVAAACDL ITCA                                                         674
//

If you have problems or comments...

PBIL Back to PBIL home page