(data stored in ACNUC1104 zone)

EMBL: CP002026.PE423

CP002026.PE423       Location/Qualifiers
FT   CDS             435821..436906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0427"
FT                   /product="fructose-bisphosphate aldolase, class II, Calvin
FT                   cycle subtype"
FT                   /EC_number="4.1.2.13"
FT                   /note="TIGRFAM: fructose-bisphosphate aldolase, class II,
FT                   Calvin cycle subtype; ketose-bisphosphate aldolase; KEGG:
FT                   nha:Nham_4048 fructose-1,6-bisphosphate aldolase; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87760"
FT                   /db_xref="GOA:D7A342"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7A342"
FT                   /inference="protein motif:TFAM:TIGR01521"
FT                   /protein_id="ADH87760.1"
FT                   /translation="MARITLRQLLDHAAEHGYGVPAFNINNMEQGIAIMDAAQAVDAPV
FT                   IMQASRGARSYAGDIMLARMIDALTEMYPSIPICMHQDHGNNEATCLSAIQHGFTSVMM
FT                   DGSLKADAKTPADYDYNVTITRRVVDAAHWVGASVEGELGVLGSLEHGSGEQEDGHGAE
FT                   GALSHDQLLTDPDQAVDFVARTKVDALAIAMGTSHGAYKFTRKPDGDILAMHVIEEIHR
FT                   RLPSVHLVMHGSSSVPQALQDLFNASGGEMPQTWGVPVEEIVRGIRHGVRKVNIDTDCR
FT                   LAMTAQFRKVGQANRSEFDPRKFLKPAMDAMRDLCRERFEQFGTAGHAAQIKVLPLAAM
FT                   AKRYASGALDPVIGGAQAAAE"
     MARITLRQLL DHAAEHGYGV PAFNINNMEQ GIAIMDAAQA VDAPVIMQAS RGARSYAGDI        60
     MLARMIDALT EMYPSIPICM HQDHGNNEAT CLSAIQHGFT SVMMDGSLKA DAKTPADYDY       120
     NVTITRRVVD AAHWVGASVE GELGVLGSLE HGSGEQEDGH GAEGALSHDQ LLTDPDQAVD       180
     FVARTKVDAL AIAMGTSHGA YKFTRKPDGD ILAMHVIEEI HRRLPSVHLV MHGSSSVPQA       240
     LQDLFNASGG EMPQTWGVPV EEIVRGIRHG VRKVNIDTDC RLAMTAQFRK VGQANRSEFD       300
     PRKFLKPAMD AMRDLCRERF EQFGTAGHAA QIKVLPLAAM AKRYASGALD PVIGGAQAAA       360
     E                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page