(data stored in ACNUC1104 zone)

EMBL: CP002026.PE425

CP002026.PE425       Location/Qualifiers
FT   CDS             438600..439019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0429"
FT                   /product="Ribulose-bisphosphate carboxylase"
FT                   /EC_number="4.1.1.39"
FT                   /note="KEGG: bbt:BBta_0452 ribulose 1,5-bisphosphate
FT                   carboxylase small subunit; PFAM: ribulose bisphosphate
FT                   carboxylase small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87762"
FT                   /db_xref="GOA:D7A344"
FT                   /db_xref="InterPro:IPR000894"
FT                   /db_xref="InterPro:IPR036385"
FT                   /db_xref="UniProtKB/TrEMBL:D7A344"
FT                   /inference="protein motif:PRIAM:4.1.1.39"
FT                   /protein_id="ADH87762.1"
FT                   /translation="MRITQGAFSFLPDLTDEQITKQVQYCIDKGWAVNIEFTDDPHPRN
FT                   TYWELWGQPMFDVRDAAGVMFELNACRKAYAGRHYIRVSAFDSTHTWESLRLSFITDRP
FT                   AEEPGFALERQEVDGRSIRYTTRAYAANRPEGARY"
     MRITQGAFSF LPDLTDEQIT KQVQYCIDKG WAVNIEFTDD PHPRNTYWEL WGQPMFDVRD        60
     AAGVMFELNA CRKAYAGRHY IRVSAFDSTH TWESLRLSFI TDRPAEEPGF ALERQEVDGR       120
     SIRYTTRAYA ANRPEGARY                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page