(data stored in ACNUC1104 zone)

EMBL: CP002026.PE426

CP002026.PE426       Location/Qualifiers
FT   CDS             439307..440251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0430"
FT                   /product="CbbX protein"
FT                   /note="TIGRFAM: CbbX protein; PFAM: AAA ATPase central
FT                   domain protein; KEGG: rsp:RSP_1280 CbbX protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87763"
FT                   /db_xref="GOA:D7A345"
FT                   /db_xref="InterPro:IPR000470"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:D7A345"
FT                   /inference="protein motif:TFAM:TIGR02880"
FT                   /protein_id="ADH87763.1"
FT                   /translation="MDAVIDEPKAAGATKPTAIDLRAEFASSGLAEVLEQLDRELVGLG
FT                   PVKQRLREIGALLLVDRARARFDLQAVSPTLHMSFTGNPGTGKTTVALRMAEILHRLGY
FT                   VRKGHLVTVTRDDLVGQYIGHTAPKTKEVLKRAMGGVLFIDEAYYLYRPENERDYGQEA
FT                   IEILLQVMENQRDDLVVILAGYGDRMERFFMANPGFRSRVAHHIDFPDYSGEELEAIGG
FT                   RILETMNYRMSAGAQEAFQRYIDLRMQQPHFANGRSIRNALDRARLRQANRLFNSERPV
FT                   TAADLATIEAEDILASRVFSGGIDSYPPLRAAD"
     MDAVIDEPKA AGATKPTAID LRAEFASSGL AEVLEQLDRE LVGLGPVKQR LREIGALLLV        60
     DRARARFDLQ AVSPTLHMSF TGNPGTGKTT VALRMAEILH RLGYVRKGHL VTVTRDDLVG       120
     QYIGHTAPKT KEVLKRAMGG VLFIDEAYYL YRPENERDYG QEAIEILLQV MENQRDDLVV       180
     ILAGYGDRME RFFMANPGFR SRVAHHIDFP DYSGEELEAI GGRILETMNY RMSAGAQEAF       240
     QRYIDLRMQQ PHFANGRSIR NALDRARLRQ ANRLFNSERP VTAADLATIE AEDILASRVF       300
     SGGIDSYPPL RAAD                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page