(data stored in ACNUC1104 zone)

EMBL: CP002026.PE427

CP002026.PE427       Location/Qualifiers
FT   CDS             440368..441048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0431"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="TIGRFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   azc:AZC_1810 ribulose-phosphate 3-epimerase; PFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87764"
FT                   /db_xref="GOA:D7A346"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:D7A346"
FT                   /inference="protein motif:TFAM:TIGR01163"
FT                   /protein_id="ADH87764.1"
FT                   /translation="MALIAPSMLASDFARLGEEVRAVDAAGADWIHLDVMDGHFVPNIT
FT                   FGPDVIKAMRPHTDKVFDVHLMIAPVEPYIEAFAKAGADIITVQAEATDHLDRCLQLIR
FT                   SLGKKAGVALNPATHESVLAYVLEKTDLILAMTVNPGFGGQAFIPDVVPKLHRLRAMIG
FT                   GRPIHLEVDGGVTPETAPLCTEAGANVLVAGSAVFKGGADAYAANIAAIRGSCRPARGQ
FT                   SAAA"
     MALIAPSMLA SDFARLGEEV RAVDAAGADW IHLDVMDGHF VPNITFGPDV IKAMRPHTDK        60
     VFDVHLMIAP VEPYIEAFAK AGADIITVQA EATDHLDRCL QLIRSLGKKA GVALNPATHE       120
     SVLAYVLEKT DLILAMTVNP GFGGQAFIPD VVPKLHRLRA MIGGRPIHLE VDGGVTPETA       180
     PLCTEAGANV LVAGSAVFKG GADAYAANIA AIRGSCRPAR GQSAAA                      226
//

If you have problems or comments...

PBIL Back to PBIL home page