(data stored in ACNUC1104 zone)

EMBL: CP002026.PE428

CP002026.PE428       Location/Qualifiers
FT   CDS             complement(441210..442082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_3279 2-oxoglutarate dehydrogenase E2
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87765"
FT                   /db_xref="GOA:D7A347"
FT                   /db_xref="UniProtKB/TrEMBL:D7A347"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87765.1"
FT                   /translation="MTDMTEPSPESPGPRPSDVPTGAKPSGPAAPASRSKGPPQDPEAF
FT                   QRWIGIERLKVDMRRLELETKRMEAPETMPPRRRSPVLPILYGVILVALVGLTAFLASQ
FT                   VLALRGEIGALRTAQTEIGQRLAAAESEQTGLREAVEAAQTKANAAASVQPAPQASSQT
FT                   PAAPSVAPADASSQAAAPAAPDPALPGSGYTVRIFAPVNAVAKAKIDGFVNPLKAAGYD
FT                   VVVSDTGVVQTTSNSLSYHASSEEMAKRLSTLIQQKKPALAMEMRASPSIPPSARQILI
FT                   LNLTEDAFK"
     MTDMTEPSPE SPGPRPSDVP TGAKPSGPAA PASRSKGPPQ DPEAFQRWIG IERLKVDMRR        60
     LELETKRMEA PETMPPRRRS PVLPILYGVI LVALVGLTAF LASQVLALRG EIGALRTAQT       120
     EIGQRLAAAE SEQTGLREAV EAAQTKANAA ASVQPAPQAS SQTPAAPSVA PADASSQAAA       180
     PAAPDPALPG SGYTVRIFAP VNAVAKAKID GFVNPLKAAG YDVVVSDTGV VQTTSNSLSY       240
     HASSEEMAKR LSTLIQQKKP ALAMEMRASP SIPPSARQIL ILNLTEDAFK                  290
//

If you have problems or comments...

PBIL Back to PBIL home page