(data stored in ACNUC1104 zone)

EMBL: CP002026.PE43

CP002026.PE43        Location/Qualifiers
FT   CDS             33487..33882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_0687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87380"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZW6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87380.1"
FT                   /translation="MDELRVICVECTCGRRWWGRSSEVGFRSIQDLAGRMVCRGCGARN
FT                   VSVAYADHVAVPAPEPNELWASVEIWDDAGIRIQETMARVGNLGVGVAAYERTLLERPN
FT                   RNVTLRDRARIIRSTARDRERRGKRLD"
     MDELRVICVE CTCGRRWWGR SSEVGFRSIQ DLAGRMVCRG CGARNVSVAY ADHVAVPAPE        60
     PNELWASVEI WDDAGIRIQE TMARVGNLGV GVAAYERTLL ERPNRNVTLR DRARIIRSTA       120
     RDRERRGKRL D                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page